KEGG   Torulaspora delbrueckii: TDEL_0B04530Help
Entry
TDEL_0B04530      CDS       T02236                                 

Gene name
TDEL0B04530
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tdl  Torulaspora delbrueckii
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TDEL_0B04530 (TDEL0B04530)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    TDEL_0B04530 (TDEL0B04530)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TDEL_0B04530 (TDEL0B04530)
Protein phosphatases and associated proteins [BR:tdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TDEL_0B04530 (TDEL0B04530)
Transcription machinery [BR:tdl03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TDEL_0B04530 (TDEL0B04530)
Spliceosome [BR:tdl03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TDEL_0B04530 (TDEL0B04530)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(799721..800482,800641..800817))
Genome map
AA seq 312 aa AA seqDB search
METPAVDVDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQQGGRKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagactccagcggttgatgtcgataatattatcgatagattattagaagtaagaggt
tccaaaccgggacaacaggtcgatttggaagagcacgaaattagatacttgtgttccaag
gccagatccatattcatcaaacagcctatcttactggaactagaagcacccatcaagata
tgtggtgatattcatggtcaatattatgatttgttacgtctatttgagtatggtggtttc
ccaccagaatccaattatttgtttttaggtgattacgtcgatcgtggtaaacaatcccta
gagacaatttgtcttctgttggcttacaagatcaagtaccctgagaattttttcattcta
agaggtaatcacgaatgtgcgtcgattaatagaatttatggtttttacgatgagtgcaag
agacgttataacatcaaactatggaagacttttacagattgttttaactgtttaccaatc
gcagctattatcgatgaaaagattttctgcatgcatggtggtctttctccagatttgaac
agtatggaacagattagaagagttatgagaccaacggatatacctgatgtcggattgctt
tgtgacttgttatggtccgatcctgataaggatattgttggttggagtgaaaatgataga
ggtgtttcgttcacatttggtcccgatgtggttaatagattcttacagaaacaggatatg
gaacttatttgcagagctcatcaagtggtagaagacggttatgagttcttcagtaagaga
caactggtaacattattcagtgctccaaactattgtggtgaatttgataacgctggtgcg
atgatgagtgtcgatgagagtctactatgctctttccagattttgaagccagctcagaaa
agcttaccaagacaacaaggtggtagaaagaagaaatag

DBGET integrated database retrieval system