KEGG   Torulaspora delbrueckii: TDEL_0B05190Help
Entry
TDEL_0B05190      CDS       T02236                                 

Gene name
TDEL0B05190
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tdl  Torulaspora delbrueckii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0B05190 (TDEL0B05190)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TDEL_0B05190 (TDEL0B05190)
   00630 Glyoxylate and dicarboxylate metabolism
    TDEL_0B05190 (TDEL0B05190)
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TDEL_0B05190 (TDEL0B05190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:912345..914009
Genome map
AA seq 554 aa AA seqDB search
MVKVSLDNVKLLVDIDREPQFTPSKTTVADILTKEALEFVVLLHRTFNGRRKQLLENRQT
VQKKLDSGSYKLDFLPETAKIRDDPTWQGNILAPGLIDRSTEITGPPVRNMLVNALNAPV
TTYMTDFEDSASPTWNNQIYGQVNLYDAVRDQIDFSTPKKQYKLNGSIRDLPTLIVRPRG
WHMVEKHLYVDDEPISASMFDFGLYFFHNAHKLIEIGKGPYFYLPKMEHHLEAKLWNDIF
NVSQDYIGMPRGTIRATVLIETLPAAFQMEEIIYQLRQHSSGLNCGRWDYIFSTIKRLRN
LPGHVLPDRDQVTMTSPFMNAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPVANEKAMTK
VRKDKIRELTNGHDGSWVAHPALAPICNEVFVNMGTRNQIHFVPDVKVSAQDLVNTTIEG
GKVTTEGIIQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLHQWVKHGVTLSD
TGERVTPQLTAKILKEQVDRLSASSLVGSRNKFALAAKYFLPEITGEKFSEFLTTLLYDE
IVTVKDKPTDLSKL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagtcagtttggacaacgttaaactactagtggatatcgatcgtgagccccag
ttcactccttccaagactacagtggctgatatcttgactaaagaagctttggagtttgtt
gttttgttgcatagaactttcaacggcagacgtaagcaattgctagagaatcgtcaaact
gtgcagaagaaattggattctggttcatataagttggattttttgccagagacggcgaag
attagagatgacccaacttggcaaggaaatatcttggcccctggtttgattgaccgttct
acggagatcacgggaccacctgtgagaaacatgttggtcaatgcgttgaacgcgcctgtg
actacttatatgaccgattttgaagattctgcttctccaacttggaataatcagatttac
ggtcaagttaatttgtacgatgccgtacgtgatcaaattgactttagtaccccaaagaaa
cagtacaagttgaatggttctatccgcgatttacccacgttgattgtgaggcctcgtggt
tggcatatggttgagaagcatctgtatgtcgacgatgaacctatcagtgcttctatgttt
gattttggtctatatttcttccacaatgctcataaactaattgaaatcggtaagggtcct
tacttttatttgcccaagatggaacatcatttggaagccaaattgtggaatgatatcttt
aacgtgtcacaggattacatcggtatgcctcgtggtacgattagagctacggttttgatt
gaaactttgccagctgctttccaaatggaagaaattatctaccaattgaggcaacactct
agtggtctaaactgtggtcgttgggattacattttctcgactattaaacgtttgagaaac
ctaccaggccatgtgctaccggaccgtgatcaagtcaccatgacttcgcctttcatgaac
gcttacgtgaaaagactaattaacacttgtcatcgtcgtggtgtgcacgccatgggtggt
atggctgctcaaattccaatcaaggatgaccctgtggctaacgaaaaggcaatgacgaag
gttcgtaaggataagattcgtgaattgaccaatggtcatgatggttcgtgggtcgctcac
ccagcattggctccaatttgtaacgaagtttttgttaacatgggtactcgcaaccaaatt
cattttgttcctgacgtcaaagtcagcgcacaggatttggttaacactactatcgaaggt
ggtaaagttaccaccgaaggtatcattcagaacctagatatcggtctacaatacatggaa
gcttggttaagaggttctggttgtgttccaatcaataatttgatggaagatgctgctact
gctgaagtgtctcgttgtcaactacatcaatgggttaagcacggtgtcactttgagcgat
accggtgaacgtgtcacccctcaactaactgcaaagattctaaaggaacaagttgataga
ttatcagcttctagtcttgttggatccaggaataagttcgctctcgcagccaaatacttt
ttgccagaaataacaggagaaaaattcagtgaatttctaactacactgctttatgacgag
attgttaccgtcaaggataagccaaccgatctaagcaagctctaa

DBGET integrated database retrieval system