KEGG   Torulaspora delbrueckii: TDEL_0B05680Help
Entry
TDEL_0B05680      CDS       T02236                                 

Gene name
TDEL0B05680
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tdl  Torulaspora delbrueckii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TDEL_0B05680 (TDEL0B05680)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TDEL_0B05680 (TDEL0B05680)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TDEL_0B05680 (TDEL0B05680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1002288..1004396
Genome map
AA seq 702 aa AA seqDB search
MSIPENVKGAVDFDPWLTPFAQVLSERRNLADKWVHDLTHATPDGSYQSLVKFTRDSYLS
YGFHADARTKEIRYKEWAPNARQAFLIGDFNGWNETSHELKHKDEFGNFSITVPPTSAGD
FAIPHDSKIKVMFVLPDGSKIYRIPAWIKRATQPDKETAKLFGPIYEGRFWNPPKPYEFK
NKRPSFNEKADSLRIYEAHIGISSPEPKIASYKEFTRDVLPRIKHLGYDAIQLMAIMEHA
YYASFGYQVTNFFAISSRFGTPEDLKELVDTAHGMGILVLLDVVHSHASKNVEDGLNNFD
GSDHQYFHSLASGRGEHPLWDSRLFNYGSFEVQRFLLSNLAFYIDVYQFDGFRFDGVTSM
LYVHHGAGEHGGFSGDYNEYLSRDRSYVDEQALAYLMLANDLVDELLPKSAITIAEDVSG
YPTLCLPRSMGGAGFNYRLAMALPDMWIKILKEQKDEDWDMSKIVHTLTNRRHGEKVVAY
CESHDQALVGDKTLAFWLMDAAMYTDMTVLKPGTPVIDRGIALHKLIRLLTHSLGGEAYL
NFEGNEFGHPEWLDFPNKNNGDSYHYARRQFNLVDDKLLRYRHLYEFDAGMQHCERQHQW
LNTPQAYVSLKNESDKVIAFERNGLLFIFNFHPTQSFTDYRIGVEVAGTYKIVLNTDRKE
YGGFERVDENSRFHTTDLAWNNRKNFVQVYIPSRVALVCALE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcctgaaaatgtcaaaggagctgtggatttcgacccatggttaacgccgttt
gctcaggttttatctgaacgaagaaatttggcagataaatgggttcacgatttgacgcat
gctacaccggatggttcgtatcagtccttagtaaaatttaccagagattcgtatctttcc
tatggattccacgccgatgccagaaccaaggaaatccgatacaaggaatgggcccctaac
gccaggcaagccttcctgattggtgatttcaatggttggaatgaaacatcacatgaattg
aagcataaggatgaatttggtaattttagcataaccgttcctccaacttcggccggagat
tttgcgattcctcatgatagtaagattaaagtcatgtttgtcttgccagatggatccaag
atttatagaattcctgcttggataaaaagggcaactcaaccagataaggagactgctaaa
ctttttggacccatttatgaagggagattttggaacccgccaaagccatacgaattcaag
aacaaaaggccctctttcaatgaaaaagctgattctctgagaatttatgaagctcacatt
ggtatttcatcacctgagccaaaaattgcttcatataaggagtttacaagagatgtctta
ccccgtataaagcatttgggttacgatgctatacagttgatggcaattatggagcatgcg
tactatgcctcgtttgggtatcaagtgaccaacttcttcgcaatcagttctcgttttggt
actcctgaagatttgaaggagttggttgataccgctcatggaatgggcattttggttcta
ctggacgttgtccatagtcatgcttccaagaacgtcgaggatggtttaaataattttgac
ggctcggatcatcaatactttcattcattggcatcaggcaggggcgaacatccattatgg
gactctcgtcttttcaattatggtagctttgaggttcaaagatttttactctccaacttg
gcattttacatcgacgtttatcaattcgacggttttagatttgatggtgtcacttcaatg
ctatacgtacaccatggtgcaggggaacatggtgggttcagtggtgactacaatgagtat
ttatcccgtgatagatcttatgttgatgaacaggctttagcctacctaatgctggccaac
gatctggttgatgagctacttccaaaatcggcgatcacgatagctgaggatgtttctggt
tatccaacattatgcttacctcgttccatgggaggcgctggattcaactatagactggca
atggctttgccagatatgtggataaagattttgaaggagcagaaggatgaagactgggat
atgtcaaagatagtgcatacattgaccaatagacgtcatggcgagaaagttgtcgcttac
tgcgagtcgcatgaccaagccttggtcggtgataagactctggcattctggttgatggac
gcggccatgtatacagatatgactgtcctgaaacccggtacgccagtcatagatcgtggt
attgcattgcacaagctgattaggcttctcactcattcgttgggtggtgaagcttaccta
aactttgaaggtaacgaattcggtcaccccgagtggctagatttcccaaataagaacaac
ggcgatagttaccattatgctcgtagacaatttaatttggttgatgataagttgctgcgt
tatcggcacctgtatgagtttgatgcaggaatgcaacactgcgaaagacaacatcaatgg
ctgaacacccctcaggcatacgtctcattgaaaaacgaatcagataaagtgatagcattc
gagcgtaacgggttgctgttcatcttcaatttccatccaactcaaagttttactgattac
agaattggcgttgaagttgccggtacctacaagattgttctgaataccgatagaaaggag
tatggtgggtttgaaagagttgacgagaactcgaggttccacaccactgacctggcctgg
aataacagaaagaactttgtacaggtttacattccatcaagagtcgcactggtttgcgcg
ctagaatag

DBGET integrated database retrieval system