KEGG   Torulaspora delbrueckii: TDEL_0B06310Help
Entry
TDEL_0B06310      CDS       T02236                                 

Gene name
TDEL0B06310
Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TDEL_0B06310 (TDEL0B06310)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TDEL_0B06310 (TDEL0B06310)
Glycosyltransferases [BR:tdl01003]
 Polysaccharide
  Storage polysaccharide
   TDEL_0B06310 (TDEL0B06310)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1116175..1118283
Genome map
AA seq 702 aa AA seqDB search
MPRDLQNSLLFEVATEVANRVGGIYSVLKSKAPVTVAQYKDNYTLIGPLNRATYQGEVEP
IDWSSREAFSDELRPIQNVLQSMTSRGVRFVYGRWLIDGSPRVLLFELDSVAGYLNEWKG
DLWSLVGIPSPEHDPETNDAIMLGYTVAWFLGELAHLDHQHAIIAHFHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCAAGNVDFYNDLAKFDVDAEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKINEFVRGH
FHGSFDFDLDNTLYFFTAGRYEYKNKGADMFIEALARLNYRMKVSGSKKTVVAFIIMPAK
NKSFTVEALRSQAVVKALENSVNEVTSLVGKRIFEHAMRYPHMGVHQEIPTDLDELLKSS
DRVLLKKRVLALRRPDGELPPVVTHNMVDDANDPILNQIRHVQLFNHPSDPVKIIFHPEF
LSANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETDQAKDYGIYIVDRRFKALDESVEQLVDDMEEFVKKNRRQRINQRNRTERLSDLLDWR
RMGLEYVKARQLALRRAYPDLFKQLVGEELNDTNMDTLAGGKKMKIARPLSVPGSPRESR
ANSTVYMTPGDLGTLQDANNADDYFSLGAGNDDDDDDFDDNV
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcgatttgcaaaatagcttgttgttcgaagtggccacggaagtggccaaccga
gttggtggtatttacagtgttttgaaatccaaggctcccgttactgtggcccaatataaa
gacaattatacgttaataggtccattgaacagagctacgtatcaaggtgaagtagaacca
attgattggagttcgcgagaggcatttagtgatgaattacgaccaattcagaatgtttta
caatcaatgacctctcgtggggtcaggttcgtttatggtagatggttaattgatggttct
cctcgtgttttgctatttgagctggactcggtagctggatatttgaatgaatggaaaggt
gacctgtggtcattggttgggattccttcaccggaacacgatccggagactaatgatgca
attatgctaggttataccgttgcttggttcttgggagaattggctcatttggatcaccag
catgctattattgctcactttcatgaatggttggcaggtgttgctttgccgttgtgccgt
aagaggcgtatcgatgtagtgacaatttttactactcatgcaactttgctgggtagatat
ttgtgtgctgctggtaacgttgatttttataacgatttggccaagtttgatgtggatgca
gaagcagggaaacgtggcatctatcaccgttactgtatcgaacgtgcagcagctcatacc
gctgatgttttcactacagtgtcacaaataacagcactggaggctgaacacttgttaaag
aggaagccagacgggatcctgcccaatgggttgaatgtggttaagtttcaggcagttcac
gaattccagaatctacatgcattgaagaaggaaaagattaacgaatttgtcagagggcat
ttccatggtagtttcgatttcgatctcgataatactttgtatttcttcacagccggtaga
tatgagtacaagaataaaggtgctgatatgtttattgaagcattggcacgtttaaactat
aggatgaaagtttcgggttcaaagaaaaccgttgttgcatttatcatcatgcccgccaag
aataaatcgttcacggtcgaagcattgagaagtcaagcggtggtcaaagccctggagaac
tccgttaacgaggtaaccagtttggttgggaaaagaatctttgaacatgcaatgagatac
cctcatatgggtgtgcatcaagaaatacctactgatttggatgagctgttgaaaagctcc
gatagagtgctgttgaagaaacgtgtgcttgcattaagaagacccgatggtgaattacca
cctgtggtcacccataacatggtcgatgacgcaaatgatccaatcttaaaccaaatcagg
cacgttcaattgttcaatcatccatcagacccagtcaagatcattttccacccagaattc
ttgtctgccaataacccgatcctcggtctggattatgacgaattcgtccgtggttgtcat
ttgggtgtgttcccttcatattacgaaccctgggggtacactcctgcagagtgtaccgtg
atgggggttccttccattaccaccaacttatctggtttcggcgcctacatggaagaccta
attgaaactgaccaggccaaagattatggtatttacatcgtggatcgtcgtttcaaagct
ttagacgagtccgtcgagcaattagttgatgacatggaagaatttgtcaagaagaacaga
agacaaagaatcaatcagagaaacagaacggaaagattatccgacttactggattggaga
cgtatgggcctcgaatacgtaaaggccagacaactcgccttgcgtagagcttatccagat
cttttcaaacaattggtaggtgaagaattgaatgataccaacatggacactttagccggt
ggtaaaaaaatgaaaattgcaagaccattgagtgtacccggatcaccacgtgagtctaga
gctaatagcaccgtttacatgactcccggtgacctagggaccctgcaagatgccaataac
gcagacgattatttcagcctgggagctggcaatgatgacgacgacgacgatttcgacgat
aacgtctaa

DBGET integrated database retrieval system