KEGG   Torulaspora delbrueckii: TDEL_0B06350Help
Entry
TDEL_0B06350      CDS       T02236                                 

Gene name
TDEL0B06350
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tdl  Torulaspora delbrueckii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TDEL_0B06350 (TDEL0B06350)
   00052 Galactose metabolism
    TDEL_0B06350 (TDEL0B06350)
   00500 Starch and sucrose metabolism
    TDEL_0B06350 (TDEL0B06350)
   00520 Amino sugar and nucleotide sugar metabolism
    TDEL_0B06350 (TDEL0B06350)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TDEL_0B06350 (TDEL0B06350)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1125291..1126796)
Genome map
AA seq 501 aa AA seqDB search
MSFQKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDDEELRNRFENQLDSFFSLF
RRYLVEKSSGNTLDWEKIKSPSAEEVIPYKSLSEHQPESVSSLSKLAVLKLNGGLGTSMG
CVGPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANR
IRIRSFNQSRYPRVFKDSLLPVPTHYDDPLDSWYPPGHGDLFESLHASGELDALIAQGRE
ILFVSNGDNLGATVDLKILNHMIDTGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQ
VPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRLVESTALQMEIIPNGKTIKRNGQEVNVL
QLETACGAAIRHFEGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLEHGSLTIDPSRFGPN
PLIKLGSDYKKVSGFNARIPHIPKIVELDHLTITGNVYLGKNVTLKGTVIIVCSDGHKID
IPNGSVLENVVITGNLQILEH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcaaaagaaacacaccaagactcactctacgtatgctttcgagagtaatacg
aacagtgtagctgcttctcagatgagaaatgccctgaacaagcttgcagactctgtaaag
gatgatgaagagctgcgcaacaggtttgagaaccaattggactcctttttcagtctattt
agaaggtacttggtcgagaaatcgtcaggtaacactttggattgggaaaagatcaagtct
ccttccgctgaagaagtgattccttacaaatctttgtctgaacatcaaccagagagtgtt
agcagcctgtctaagttggctgtgttaaagctgaacggtggtttaggtacatctatgggc
tgtgttgggcccaaatctgtgatcgaggttagagaaggtaacacgttcttagatctatct
gtgagacagattgagtatttgaacagacagtatgatagtgatgttcctttgctgttgatg
aattctttcaacacagacaaggataccgaacatttgatcaaaaagtactctgcaaacaga
atcagaattagatctttcaaccaatcgagataccctcgtgtttttaaggactcgctattg
ccagtacctacccactatgacgatccattggattcctggtatccacctggtcatggtgat
cttttcgagtcattacatgcttctggtgaactggatgcgttgatcgcacaaggcagagag
atcttgtttgtctccaacggtgacaacttgggtgctactgttgatctaaagatcctgaac
cacatgattgacactggtgctgagtacatcatggaattgactgacaagactagagctgat
gtgaaaggtggtactttgatctcatatgatgggcaagttcgtcttttggaagtggcccag
gtgccaaaggaacacattgatgaattcaagaacatcagaaaattcacaaatttcaacaca
aacaacttatggattaacttgaaagctgtgaagagactggtggaatccactgctttgcaa
atggagatcattccaaatggtaagaccataaagagaaatggccaagaggttaacgttcta
caattggagactgcctgtggtgccgccatcagacatttcgagggtgctcacggtgtggtc
gtcccaagatcaaggttcttgcctgtcaagacttgctcagatctgctattggttaaatcc
gatctattctacttggagcacggttctctaaccatagacccctcgagattcggtccaaac
ccactcatcaaattaggttctgactacaagaaggtctctggtttcaatgcaaggatacct
cacattccaaagatcgtggaattggaccatttgaccattacaggtaatgtttacttgggc
aagaatgttactttgaaaggtaccgttatcatcgtttgttccgacggtcacaagatcgac
atccccaacgggtcagttttggagaacgttgtcatcactggtaacttacaaatcctagaa
cactga

DBGET integrated database retrieval system