KEGG   Torulaspora delbrueckii: TDEL_0C01190Help
Entry
TDEL_0C01190      CDS       T02236                                 

Gene name
TDEL0C01190
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0C01190 (TDEL0C01190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:203792..204961
Genome map
AA seq 389 aa AA seqDB search
MSITDFQPAVWTTSSNNALKVSLVSDNAIQFSPTFTYPIYGESEQIFGFQDLLIHLAFDS
VTFRPFVNVKYGAKLDEEADDVEGKLLSFLPKDDVVIKDESEWIDGFQKEQEGYKLPSSK
FEIGRYKHDGDQFVIFKMSIAEDFTKKLHRRVQIFSLLFIEAASYIDEEDPNWEIFWLFN
ERTKQCAGYVSTYKLWRYLGSDDFDSSADLKYRARISQFIIFPPYQGKGHGSHLYSAIFS
HWLADDSVTEITVEDPNESFDDLRDRNDLEKLYELKVFSQVPRAGEITSHWIEETRVQLK
IEKRQFNRLIEMILAYSNAKNFRIQVKRRLYIKNYDALFDMPDSERKDALQKSFLLLADD
YKRIISLCRFNKRPANRSDEETPSKKIKN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattacggattttcagcctgcagtttggaccacttcatccaataacgcgttaaaa
gtctctttggtcagtgacaacgcaattcaattctcgcccacttttacttacccaatctac
ggcgaatcagaacagatattcggctttcaagatttgttgatccaccttgcttttgattca
gtgacattcaggccgtttgtaaacgtcaagtatggtgccaaattggacgaagaagctgat
gacgtcgagggaaaactattaagtttcttgcctaaagatgacgttgtcatcaaagatgaa
tcagaatggattgatggtttccagaaggagcaggaaggatataagctaccaagttctaaa
ttcgagatcggaagatacaaacacgatggggatcaattcgttatcttcaagatgagtatc
gccgaagactttaccaaaaaattacatcgccgagtccagatattctcgcttttgtttatt
gaagctgcctcttacatcgatgaagaggatccaaactgggaaattttctggcttttcaat
gaaaggaccaagcaatgtgctggttacgtgagcacgtataagttgtggagatacttaggg
tctgatgactttgatagttctgctgatctgaaatatagagcacgaatctcacagttcata
atattcccgccataccaaggtaaggggcacggatctcatctttacagtgctatattctct
cactggctggcggacgacagtgtgactgaaattacagtcgaggaccctaatgaaagcttc
gacgacctaagagatcgtaatgatctggaaaagttatatgagttgaaagtattctcgcaa
gttcctagagcgggtgaaatcacgtctcactggatagaggaaacacgagttcaactgaag
atcgaaaagcgccaatttaaccgcctcattgagatgatccttgcctacagcaatgccaaa
aactttcgcatacaggttaaaaggcgattatacattaaaaactacgatgcactattcgat
atgccagattccgaacgcaaagatgcacttcagaaatccttcttattgttggccgatgac
tacaaacgcattatatccctctgccgattcaacaaacggccagcaaatcggtctgatgag
gaaacaccatcgaagaagataaaaaactag

DBGET integrated database retrieval system