KEGG   Torulaspora delbrueckii: TDEL_0C01320Help
Entry
TDEL_0C01320      CDS       T02236                                 

Gene name
TDEL0C01320
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0C01320 (TDEL0C01320)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TDEL_0C01320 (TDEL0C01320)
Enzymes [BR:tdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TDEL_0C01320 (TDEL0C01320)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(224778..226448)
Genome map
AA seq 556 aa AA seqDB search
MYGWNFSRCFNKRHYSHDLQNVFKEEVKKVNEWWATPRFRHIHRPYSAEDVVKHRGSLPL
EVTRYPSSYQAQRLFQLLDEKFHKREPLHTLGVIDPVQMSQLARCKDIHVAYISGWACSS
TLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQMHDRKLMLEKLGPHKKEIEETNYLKPI
IADADMGHGGTTTVMKVAKLFAEKGAAGIHLEDQLVGGKRCGHLSGAVIVPTSTHVSRLV
ATRFQWDLMGTENLLIARTDSCNAKLLSSSSDPRDHQYIKGVINPQAVAWSEILTQLESG
ATESTAIAEAETEWYEQNKIMTFDEAVEQQVNRDQYDTYLEKKANKMSKLNRVYLSLAEM
RKLAALAAPKQQIFFDWDKPRTKEGHYMFQGCMEAAIGRSLAFARYADMLWLETKTPDLK
QAGSFASTIHNVYPEARLVYNLSPSFNWSSHGYTAEALQSFIWDLAKHGFILQLVSLAGL
HVDALSFWQLARRFQKDGMRAYVEQVQRIEKAENCDILTHQKWSGVEYIDSLSKVLDGSS
SHTSSTSGDSYTESQF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttggaacttctcgagatgctttaataagagacattactcccatgatttgcag
aacgttttcaaggaagaagtgaagaaagttaatgaatggtgggcaactccacggttccgt
catattcatagaccttatagtgccgaggacgtggtaaagcaccgtggtagtctcccacta
gaagtgacgagatacccatcatcgtatcaagctcagcgtctttttcagttgctggatgaa
aaattccacaagagggaaccattgcacactctcggtgtcatcgaccccgtgcaaatgagt
cagttagccaggtgcaaggacattcacgtcgcttacatatccggatgggcgtgctcttct
acgttggtggggtcaactaatgaagtttcaccagattttggcgactacccctacgatact
gtcccaaatcaagttgaaaggatcttcaaagcccagcaaatgcatgataggaagctaatg
ctagaaaaattgggtccccacaagaaagaaatcgaagagacaaactatttgaagccaata
atcgctgatgcagatatgggccatggcggtaccacgacagtaatgaaagtggccaagttg
tttgctgagaaaggtgccgctggtatccacttggaggaccaactggtgggaggcaagaga
tgtggtcatctaagcggtgcagtcattgttcccacatcgacgcatgtctccagactagtt
gcaacaaggttccagtgggatttgatgggcacagagaacctcttgatcgccagaacggac
tcttgcaatgccaaattgctaagcagtagtagtgaccctagagatcaccagtacatcaag
ggcgtcattaatccgcaggcggttgcatggagtgaaatactgacacagctagaaagcggt
gccacagagagcacggcaattgcagaagcagaaacagaatggtacgaacagaataagatc
atgaccttcgatgaggcggttgaacagcaagtgaaccgggatcaatatgatacctatctt
gaaaagaaagctaacaagatgagtaaattgaatagggtatatttgagcctggcagaaatg
agaaaactcgccgctctagccgctccaaagcagcagatctttttcgactgggacaaacca
cgcaccaaagagggtcactacatgttccaaggctgcatggaggctgccatcggtagatca
ctggcttttgcccgttatgcagacatgctttggctcgagacaaagactcccgatttgaaa
caagccggctcgtttgcttctacaattcacaacgtatacccagaggcaagattagtctac
aacttatcaccaagtttcaactggagctcccatggttacactgcggaagctttgcagagt
ttcatctgggacttggccaagcacggattcattttgcaactagtttccctagctggtctg
cacgtcgatgccctctccttctggcaactagctcgtagattccaaaaagacggcatgaga
gcttacgtcgaacaagtccaaagaatcgagaaggcagaaaactgtgacatcctaacgcac
caaaaatggtctggagtcgaatacattgactcgttgtcaaaagtgctggatggatcttcc
tcccacacctcgagcacatctggtgatagttacacggagtcgcagttctaa

DBGET integrated database retrieval system