KEGG   Torulaspora delbrueckii: TDEL_0C01760Help
Entry
TDEL_0C01760      CDS       T02236                                 

Gene name
TDEL0C01760
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0C01760 (TDEL0C01760)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(306152..308440)
Genome map
AA seq 762 aa AA seqDB search
MKKVPNSQHSEHNEDQDDSVGAQRLQDGLGAMRANKLLRSLEISDNIHSKVARHAFDNPN
GTRSTRSRHDVVEQLKPEIAIQKHINGGLEDSRTTLDTVKSFKSQTSIRGIPSNIEEANL
LNPNVQFISDNVGESISADFSTVKIRYNPLKFLNFQRLLRASSELQDREKNSHYRHDFNV
NEPEDLAYMLDNDSAVPYRCAIANKSDYSTSKTLPSSEDRELFERLLIQSSTAAYYNSNQ
LLANHDKMECEDDAPSRSKSKRRSIFFQSRKPQVKQTTKAAAIECIFIRDYEIETWYTTP
YPEEYNRNKLLYICEFCLKYMSSRYVFHRHQLKCRLFRPPGNEIYRDGKLSVWEIDGREN
VIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDLPQQSPRFHLVGYFSKEKLNSTD
YNLSCILTIPIYQRKGYGQFLMDFSYLLSRREFKWGTPEKPLSDMGLLSYRNYWGVKCAQ
VLMELKDLSKCDEEEYLQITLEDISNLTGMIPTDVVFGLEQLRVLQQSSNNELPRYVIKI
DSWEMIEKEANSWKSRGYQTLNPQKLVWKPMIFGPSCGVNAVGTMVETTGATRTTLGTGN
TTEDFFKRSISMLTNFLQDDIPDSRPMEVGAWQKIVDREPVFLPKIQSDRYYFQDPYGIK
NTFVPYEGRTASRDLSSSIEEPTDISSNPVKGGFDDEQSIESEVNGTDTGQVSLPPTAFK
NNQTNIGISSVEDDEPTIIGGFQEDSLAEPENPQRLLRSRVV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttcctaattctcaacatagtgagcataatgaggatcaagatgattcagta
ggagctcaaagattgcaagatggcttgggagccatgcgtgcaaacaagctgttaagaagc
ctggagatctcagataatatacactcgaaagttgctagacacgcattcgacaatcctaac
ggaacgcgatcaactagaagccgtcacgacgttgttgaacagcttaaacctgaaattgca
attcaaaagcacataaatggtggtttggaggacagtaggacgactttagatactgtgaaa
agttttaaatcacagacatctattaggggaattccaagtaatatagaagaagctaatctg
ctgaaccctaatgtgcagtttatatcagataacgttggagagtcaatttcagctgatttt
tctacagtaaaaatacgatacaacccattaaagtttttaaactttcaaagattattacgt
gcttccagtgagctccaagatagggaaaagaactcgcactatcgtcacgacttcaatgtt
aacgaaccagaggatttggcatacatgttggataacgacagtgccgtaccttaccgttgt
gcgattgccaataaaagtgactattcaacatccaagacattgccgagttcagaagaccgt
gagttgtttgagagattgctgattcaatcttcaaccgctgcatattataattccaaccaa
ctgttagctaatcacgacaaaatggagtgtgaggatgacgcaccttctcgtagcaaatct
aagaggaggtctatcttctttcagtccaggaaaccccaagtcaaacaaaccaccaaggct
gccgccattgaatgtatattcatcagagattatgaaatagaaacatggtacactacacct
tatccggaagagtataacaggaataaacttctctacatatgtgaattttgtttgaaatac
atgagctcgcgatacgtctttcaccggcaccaactaaagtgcaggctgtttagacctccc
ggcaacgaaatttatcgagatggcaagctttcagtgtgggaaattgacggtcgtgaaaat
gttatctactgtcagaacctatgcctattagccaaactgtttctgaactcaaagacccta
tactatgatgttgaaccatttatattttacgttctcactgaaagagaagatcttccgcaa
caatcgccccgatttcatcttgtgggttatttctccaaggaaaaattgaactcgacggat
tacaaccttagctgtatattgacgattccaatataccaaagaaagggctatggccagttt
cttatggacttttcatatctgttatcaaggagagaatttaaatggggaacacccgagaag
ccactgtcagacatgggtcttttatcataccgaaattactggggagttaagtgcgctcaa
gttctaatggagctaaaagatttatcgaaatgtgacgaagaagaatatttgcaaataact
ctagaagacatatcgaacctgactgggatgataccgaccgatgtcgtctttggtcttgaa
cagttgagggtacttcaacaaagtagcaataatgaactaccgcggtacgtaatcaagatt
gattcatgggagatgattgagaaagaagctaacagctggaaatctagaggctaccaaacg
ttgaatcctcaaaaactggtttggaagccaatgatttttggtccttcttgtggtgtcaat
gctgttggtaccatggtcgagacaactggtgctacgcgtaccacgttaggaactggcaac
accactgaagacttcttcaagagaagtatttcaatgttgacaaattttttacaggacgat
attccagattcaagaccaatggaagttggagcatggcaaaagatagttgatagagagccc
gtatttctgccaaaaattcaaagtgataggtactatttccaggacccatatggtattaag
aatacttttgtaccatacgagggaagaactgcatctcgagatttgtccagcagcatcgaa
gagccgactgacatttcgagcaatcctgtgaaaggtggttttgatgatgagcaatcgatt
gagtcagaggtcaatgggactgatacgggacaagtaagcctgccgccaacggcgtttaaa
aataatcaaacgaatatcggcatcagcagtgtggaagatgatgagccgacgataattgga
ggatttcaggaagattctctggcagagcctgaaaatcctcagcgtctcctgaggagccga
gtagtgtag

DBGET integrated database retrieval system