KEGG   Torulaspora delbrueckii: TDEL_0C01850Help
Entry
TDEL_0C01850      CDS       T02236                                 

Gene name
TDEL0C01850
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tdl  Torulaspora delbrueckii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tdl03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(322863..323669)
Genome map
AA seq 268 aa AA seqDB search
MSWDDDVIGGSAATGDDNVLLASWDDELGDEPVMESWDAPEEPKSEPKPKSKPASGKKSK
AKSVEPEQKLMAIDVLDEKTRQELIKKAELDSDLNNAADLFAGLGVAEEHPRAAALRREQ
EALAAAAATALTKDTPIENHPLFQTAETKKDYQDLRKAVSTAVVSMHEKSSLNYASSLAI
DLIRDVAKPMSIESIRQTIATLNILMKDKEREERQARLARVKGGTAQGGAGKKKAKGAKA
NLGGAFKKDQQFDMGEVEFDDFGDDDFM
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggatgatgatgttattggtgggtctgccgctacgggagacgacaacgttctt
ttggcgtcctgggatgacgaactgggcgacgaaccagtgatggaatcgtgggatgcacct
gaggaaccaaaatccgaaccaaaaccaaagagtaagcccgcaagcggtaagaagagcaag
gcaaagagtgtggaacctgagcagaaattgatggctatcgacgttctggatgaaaaaact
cgtcaagaactaatcaagaaggcagaactagactcagacttgaataatgcagcagatttg
tttgccggtttgggagtcgcagaagagcatccaagagctgccgctctaagacgagaacaa
gaagcactagcagctgccgcagctactgctctgacaaaagacacaccaatcgaaaaccat
ccgcttttccaaacagcagaaaccaagaaggactaccaggatttgagaaaagctgtctcg
acagccgtcgtttctatgcatgagaaatcctcactcaactacgcctcttccctagccatt
gatctaatcagggatgttgccaagccaatgtcgatcgaatcgatcagacaaacgatcgca
acattaaatattcttatgaaagacaaagaaagagaagaaagacaagcaagattggctcgt
gtcaaaggtggtaccgcacaaggaggtgcaggaaagaagaaggctaaaggtgccaaggcc
aatctcggtggtgcgttcaagaaagatcaacaattcgacatgggagaagttgaattcgac
gattttggtgatgacgacttcatgtaa

DBGET integrated database retrieval system