KEGG   Torulaspora delbrueckii: TDEL_0C02110Help
Entry
TDEL_0C02110      CDS       T02236                                 

Gene name
TDEL0C02110
Definition
hypothetical protein
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:364853..366340
Genome map
AA seq 495 aa AA seqDB search
MMNPEVPNVFQGKSLQKRNFKQLSLATLEGRNKSTEILEPMATGATASVSLNLSLPKNDA
SNLYLRRGLKKKLNLDSQSIAAPMVTFDRALSTENLVAPQQQSFVVSSPTNSSPSTSTSL
TQVFTPMEDDNMQKQFGETDASMGGVIRNAEPMTINSSIQLQDLVQLGKIGSGNSGTVIK
ALHVPDSKIVAKKVIPVENNNHLVVNQLVRELTIMKSVHPHENIVSFYGAYYTQSGSNEI
VILMEYMNCGSLDKILSVYGRYCQRRQNLREEPWFNGLVISKISYAVLNGLSYLYEKYKI
IHRDIKPSNVLINSRGQVKICDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSTKGDV
WSLGLMIIELVTGEFPLGGRNDTANGILDLLQRIVNEPSPRLPSGGGYNFSREMIDFVNR
CCVKDETERSSINELLCHDFIGKYRTKDKEFRHWCKKVKFCLKEDKQIRREDNERAKLEK
KQLEKAAEAATTARR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcctgaagttcctaacgtcttccaggggaagtcgttacaaaaacgcaatttc
aaacaactgagtttggcgactctggaagggaggaataagagtaccgagattttagaaccg
atggctacgggagccacggcttcagtatctttaaatttaagtttgcctaagaatgacgcc
agtaatctgtacctccgaagaggattgaagaagaaacttaatttggatagtcagtcaatt
gccgctcccatggttacttttgatagagctttgagtactgagaaccttgttgcgccgcaa
caacaatctttcgtagtgagcagcccgacaaactcttccccttcgacgtcgacgagtttg
actcaggtttttacgcctatggaggatgataatatgcagaaacaattcggggaaacagac
gcttccatgggaggtgttataagaaatgcagagccaatgacgataaatagttcaatacaa
ttgcaagatctggtgcaattgggtaagatcggatctggaaactcgggaacggttatcaag
gcgttgcatgttccggattccaagattgtggctaagaaagttatcccagtggagaataat
aaccacctggtggtgaatcaactggtcagagagttgacaatcatgaaaagcgttcatccg
catgagaatattgtctctttctatggagcatattatacacaatcgggaagtaatgagatt
gttatcctgatggagtatatgaactgtggatcgttggacaagatcttatcggtatacgga
cgatattgtcaaagaaggcaaaacttaagagaggaaccatggtttaacggtctggtgatc
tcgaaaatttcatacgccgtactcaatggtctatcgtacctgtacgaaaagtacaagatc
attcatcgtgacattaagccttccaacgtgctcatcaacagtcgtggtcaagtaaagatt
tgcgattttggtgtctcgaagaaattgatcaattccatcgccgatacatttgtcggaacc
tccacctatatgtcaccagaacgcatacagggaaacgtctattccactaagggagatgtt
tggtcattgggtctaatgatcatcgaactggtcactggtgagttcccgcttgggggtcga
aacgatactgcgaatggtattttggatcttttacaaagaattgtcaatgaaccatcgccc
agactaccgtctggtggaggatataatttttcaagggaaatgattgattttgtgaatagg
tgctgtgttaaggatgagaccgaaaggtcctcgatcaatgagctactatgccatgacttc
attggtaaatataggacaaaggataaggaattcaggcattggtgtaagaaagttaagttt
tgtctaaaagaggacaaacagattagacgtgaagataatgaacgagccaagttggagaaa
aaacaattagagaaagccgctgaagctgctacgactgcaaggaggtaa

DBGET integrated database retrieval system