KEGG   Torulaspora delbrueckii: TDEL_0C02570Help
Entry
TDEL_0C02570      CDS       T02236                                 

Gene name
TDEL0C02570
Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tdl  Torulaspora delbrueckii
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tdl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(447382..447714)
Genome map
AA seq 110 aa AA seqDB search
MPAPYQPGSAKKGATLFKTRCLQCHTTEKGGPHKVGPNLHGVFGRHSGQAEGYSYTDANI
KKNILWDEQHMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYLAKACK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatatcaaccaggttccgctaagaagggtgcaactctattcaagactaga
tgtttgcaatgtcacaccactgaaaaaggtggtccacacaaggtcggtccaaacctacac
ggtgtctttggtcgtcattccggtcaagccgaaggttactcttacaccgatgctaacatc
aagaagaacatcttgtgggatgaacaacatatgtccgattacttggaaaacccaaagaag
tacattccaggtaccaagatggccttcggtggtttgaagaaggagaaggacagaaacgat
ttggttacttacttggccaaggcttgtaaataa

DBGET integrated database retrieval system