KEGG   Torulaspora delbrueckii: TDEL_0C02650Help
Entry
TDEL_0C02650      CDS       T02236                                 

Gene name
TDEL0C02650
Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tdl  Torulaspora delbrueckii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TDEL_0C02650 (TDEL0C02650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(460884..461978)
Genome map
AA seq 364 aa AA seqDB search
MAFFGSGSAGNSGVSTTMASERDLANDIIINIPAEDSISDIAFSPQQDFMFSVSSWDNKV
RIWDVQNGVPQGRAQYDHTAPVLCTRWTTDGTKVVSGGCDNVVKVYDVASGQSQDLGTHA
GPVKCLRYLTFGSSNTEVLVTGSWDKTLKYWDLRQPQPISTVMMPERVYTLDSKQQLLVV
GTAERHIAIIDLGNPATIFKTTQSPLKWQTRAVACYNEGDGYAVGSIEGRCAIRYVDDEQ
QRKSGFSFKCHRQTSSNRAAGTQAQSLVYAVNSIAFHPIYGTFVTAGGDGSFHFWDKNQR
HRLRGYPSLQASIPVCNFNRQGTVLAYALSYDWHQGHMGNRPDYPNVIRLHPTTDDEIKE
KKKR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcattctttggttctggatcggctggaaattctggtgtttctaccactatggcaagc
gagagggacttggcaaatgatattatcatcaatatcccagctgaggattcgatctctgat
atagcgttttcaccgcaacaggactttatgttcagtgtcagttcatgggataacaaggtt
cgcatttgggacgttcaaaatggtgttccgcaaggtcgcgcacagtacgatcatactgcg
cccgtactgtgtactagatggaccactgatggtaccaaagtggtatcaggtggttgtgac
aatgttgtcaaggtatatgatgtggccagtgggcaatcacaagatttgggaacacacgcg
gggcctgtcaaatgcctgcgttacttaacttttggatcgagtaatacggaagttctcgta
acaggttcctgggataagactctgaaatattgggatttaagacaaccgcagccgatatct
acggtgatgatgcccgagagagtttacacactggatagcaagcaacaattgctggttgtc
ggcactgcagagagacatatcgctatcatcgatctcggtaatccagctacgattttcaag
accacacaatctcctttgaaatggcaaacacgagctgtagcgtgttacaacgaaggcgat
gggtacgccgtgggttccattgagggcagatgcgctatcagatatgtggacgatgaacaa
cagagaaaatctgggttctccttcaaatgtcaccgccaaacaagcagcaaccgagctgca
ggtacccaggcacaatccttggtctatgctgttaacagcattgcattccaccccatctat
ggtacgtttgtcactgctggtggtgacggatccttccatttctgggataagaaccagagg
cacaggctaagaggttatccatcattacaagcatcgattccagtgtgtaatttcaacaga
cagggtacagtgctggcctacgcgctaagttacgactggcatcagggccatatgggcaac
agaccggactatccaaacgtgatcaggcttcacccaacaacagacgacgagataaaagag
aagaaaaagaggtag

DBGET integrated database retrieval system