KEGG   Torulaspora delbrueckii: TDEL_0C02720Help
Entry
TDEL_0C02720      CDS       T02236                                 

Gene name
TDEL0C02720
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tdl  Torulaspora delbrueckii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tdl04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:tdl04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:tdl04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:477529..479631
Genome map
AA seq 700 aa AA seqDB search
MLFGSNSNSNLNNAPMNADDLTTDVNTLNTIVKLQEYIQHAISQLNYETAVFLSELLYAE
CSPLEKNHVHRLESVYLYSLSLYLQGEFQTALRVSKDFKEADHMGISYIFARCCLQLDTD
LKEAVDALLNVLDKKPSVTSNGNLTHMPTVATINCLLGRLNFKLERTPESALFYSSALNA
DPYLWEAYTSLCALRATIDLKRLYSLMTKQNQSTSNRFKSRFSVSKPHSTATPYQSSNRV
PSSSSSSSSSLSLNANGSKQQSQVNALAPQHTSIKGQPTNSMLNKANVVVSTSAFSSPPS
SKQPTGKLANRSKLLTTPPSKLLHTSNFKTPRNNTLSRSSGPKRGETFSSMIVKPEHHGL
LTTALSTTATTPHTLAELILTFARVLKASSQYDSYKAIRLLENRLPSHIKSEMPWCQAQL
GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN
KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYR
RALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQ
EKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQ
LYQIMGRKKDAVKEFTVAMNLDPKGNPLIIDALEKCHSEE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgggagcaacagtaatagtaatttgaataacgctccgatgaatgcggatgat
ctcacgactgatgttaacactttgaatacgatagtcaaattacaggaatatattcagcac
gccatatcacaattgaattatgagacggcagtcttcttatcagagctactgtatgccgaa
tgctccccattggaaaagaatcatgtacacagacttgaatccgtttacctgtactcttta
tctctatatctacaaggcgagtttcaaacagctttacgagtcagcaaggattttaaagag
gctgatcatatggggattagctacatttttgcaagatgttgtttgcagcttgataccgac
ttgaaagaagcagtggatgcgttactcaatgtgcttgataaaaaaccttcagtaacttcc
aatggcaatctgactcatatgccgacagttgcaacaattaattgccttttggggagacta
aatttcaagctcgaaagaacaccggaaagtgctttattttattccagcgctttgaatgca
gatccttacttgtgggaagcatacacgtcgctttgtgcattgagagccactatcgatctg
aagaggctttattctctaatgaccaagcaaaaccaatcaacaagtaacagatttaagtcg
aggttcagcgtttcgaaaccacattcaacagccaccccatatcaaagcagcaaccgtgta
ccgtcatcttcatcatcttcatcatcgtcactatcattgaatgcaaatggatcgaagcaa
caatcgcaggtaaatgctctggcgcctcaacatacttcgataaagggacaaccaactaac
tctatgttaaataaagcaaatgttgttgtatccactagtgcattctcttcacctccttcg
tcaaagcaacctactggtaagttagcaaacagatcaaagttactcacaacacctccttca
aaattgttgcatacttcaaacttcaagactcccagaaataacactctgtctcgcagttca
ggtcccaaaaggggtgaaacattttcatcgatgattgtcaaacctgaacatcatggactt
ttgactaccgcactgtcaacaacagctactactcctcatactttagcagagttgattctt
acttttgccagagttttgaaggcctcctctcagtacgattcatacaaggctatcaggctc
ttagaaaaccggctaccatcgcatatcaaatccgagatgccttggtgtcaagctcagctg
gggaaacttcattatgagatacttaactatgaggaatctttaaatcatttcaatcaactg
agacgaatgcaaccaacaaggactcaagatattgaaatcttctcaaccttgttgtggcat
ttacacgatagtacaagattatcgcatctttcaaatgaactcgtcgagacactacccaac
aaaccgcaaacttggtgttgtttagggaacttgtactccttgcaacgagatcatgaagac
gccatcaaatattttgaaaaggccacaaagattgattacaacttcgcatatgcttacacc
ttacaaggccatgaacactcatcaaacgactcgatagatactgccaaaaactgttaccga
agagcacttgcctgtgatcctcaacattataacgcctattatggtcttggtatgtgttat
atgaagttaggtcaatatgacaaagcactactgtttttcgagaaagccagaaatatcaat
ccggtcaatgtcatcctaatatgctgctgtggagtagcccttgagaagctgtcctatcag
gaaaaggcgttacaatattatgaacaggcatgcgaattacaaccgagctcctcgctggcg
aaattcaagaaagctcatctactgtattccatggctagatacagcgctgcattagaaaat
tttgaggagcttgcaaaattggctccagatgaagctacagtgcacttcctcctaggtcaa
ctctaccagattatgggccgaaaaaaggatgcagttaaagaatttacggtcgccatgaac
ttggatccgaaagggaatcctcttatcatcgatgctttagagaaatgccattcagaggaa
tga

DBGET integrated database retrieval system