KEGG   Torulaspora delbrueckii: TDEL_0C02720Help
Entry
TDEL_0C02720      CDS       T02236                                 

Gene name
TDEL0C02720
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tdl  Torulaspora delbrueckii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    TDEL_0C02720 (TDEL0C02720)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    TDEL_0C02720 (TDEL0C02720)
   04113 Meiosis - yeast
    TDEL_0C02720 (TDEL0C02720)
Protein phosphatases and associated proteins [BR:tdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     TDEL_0C02720 (TDEL0C02720)
Ubiquitin system [BR:tdl04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     TDEL_0C02720 (TDEL0C02720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:477529..479631
Genome map
AA seq 700 aa AA seqDB search
MLFGSNSNSNLNNAPMNADDLTTDVNTLNTIVKLQEYIQHAISQLNYETAVFLSELLYAE
CSPLEKNHVHRLESVYLYSLSLYLQGEFQTALRVSKDFKEADHMGISYIFARCCLQLDTD
LKEAVDALLNVLDKKPSVTSNGNLTHMPTVATINCLLGRLNFKLERTPESALFYSSALNA
DPYLWEAYTSLCALRATIDLKRLYSLMTKQNQSTSNRFKSRFSVSKPHSTATPYQSSNRV
PSSSSSSSSSLSLNANGSKQQSQVNALAPQHTSIKGQPTNSMLNKANVVVSTSAFSSPPS
SKQPTGKLANRSKLLTTPPSKLLHTSNFKTPRNNTLSRSSGPKRGETFSSMIVKPEHHGL
LTTALSTTATTPHTLAELILTFARVLKASSQYDSYKAIRLLENRLPSHIKSEMPWCQAQL
GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN
KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYR
RALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQ
EKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVHFLLGQ
LYQIMGRKKDAVKEFTVAMNLDPKGNPLIIDALEKCHSEE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgggagcaacagtaatagtaatttgaataacgctccgatgaatgcggatgat
ctcacgactgatgttaacactttgaatacgatagtcaaattacaggaatatattcagcac
gccatatcacaattgaattatgagacggcagtcttcttatcagagctactgtatgccgaa
tgctccccattggaaaagaatcatgtacacagacttgaatccgtttacctgtactcttta
tctctatatctacaaggcgagtttcaaacagctttacgagtcagcaaggattttaaagag
gctgatcatatggggattagctacatttttgcaagatgttgtttgcagcttgataccgac
ttgaaagaagcagtggatgcgttactcaatgtgcttgataaaaaaccttcagtaacttcc
aatggcaatctgactcatatgccgacagttgcaacaattaattgccttttggggagacta
aatttcaagctcgaaagaacaccggaaagtgctttattttattccagcgctttgaatgca
gatccttacttgtgggaagcatacacgtcgctttgtgcattgagagccactatcgatctg
aagaggctttattctctaatgaccaagcaaaaccaatcaacaagtaacagatttaagtcg
aggttcagcgtttcgaaaccacattcaacagccaccccatatcaaagcagcaaccgtgta
ccgtcatcttcatcatcttcatcatcgtcactatcattgaatgcaaatggatcgaagcaa
caatcgcaggtaaatgctctggcgcctcaacatacttcgataaagggacaaccaactaac
tctatgttaaataaagcaaatgttgttgtatccactagtgcattctcttcacctccttcg
tcaaagcaacctactggtaagttagcaaacagatcaaagttactcacaacacctccttca
aaattgttgcatacttcaaacttcaagactcccagaaataacactctgtctcgcagttca
ggtcccaaaaggggtgaaacattttcatcgatgattgtcaaacctgaacatcatggactt
ttgactaccgcactgtcaacaacagctactactcctcatactttagcagagttgattctt
acttttgccagagttttgaaggcctcctctcagtacgattcatacaaggctatcaggctc
ttagaaaaccggctaccatcgcatatcaaatccgagatgccttggtgtcaagctcagctg
gggaaacttcattatgagatacttaactatgaggaatctttaaatcatttcaatcaactg
agacgaatgcaaccaacaaggactcaagatattgaaatcttctcaaccttgttgtggcat
ttacacgatagtacaagattatcgcatctttcaaatgaactcgtcgagacactacccaac
aaaccgcaaacttggtgttgtttagggaacttgtactccttgcaacgagatcatgaagac
gccatcaaatattttgaaaaggccacaaagattgattacaacttcgcatatgcttacacc
ttacaaggccatgaacactcatcaaacgactcgatagatactgccaaaaactgttaccga
agagcacttgcctgtgatcctcaacattataacgcctattatggtcttggtatgtgttat
atgaagttaggtcaatatgacaaagcactactgtttttcgagaaagccagaaatatcaat
ccggtcaatgtcatcctaatatgctgctgtggagtagcccttgagaagctgtcctatcag
gaaaaggcgttacaatattatgaacaggcatgcgaattacaaccgagctcctcgctggcg
aaattcaagaaagctcatctactgtattccatggctagatacagcgctgcattagaaaat
tttgaggagcttgcaaaattggctccagatgaagctacagtgcacttcctcctaggtcaa
ctctaccagattatgggccgaaaaaaggatgcagttaaagaatttacggtcgccatgaac
ttggatccgaaagggaatcctcttatcatcgatgctttagagaaatgccattcagaggaa
tga

DBGET integrated database retrieval system