KEGG   Torulaspora delbrueckii: TDEL_0C02940Help
Entry
TDEL_0C02940      CDS       T02236                                 

Gene name
TDEL0C02940
Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tdl  Torulaspora delbrueckii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:tdl03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tdl03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(519085..520179)
Genome map
AA seq 364 aa AA seqDB search
MTTVQANAVNIPSSKKGIPGKPPNYKRLSDDDLFRHSSQYRFWSFTPEQLEQRRIEVNAQ
AVQSIEQDLRNFIDARSTELNEEEIKTIENRAVPVNMEEELKLVNLYAKKVQTIAQRLNL
PTEIVATSITFFRRFYLENSVMKIEPKAIVLTTIFLACKSENYFIGIDSFCEKTRGDKEQ
VLKYEFPLLESLKFSLLSHHPYRPLHGFFLDIQAVLHGKVDLSYMGHIYDRCKKRITDAL
LTDAVYFYSPPQITLAVLMLEDEALTTRYLELKFHGNDTNQGNAEDEASRGNGNVTIQLD
KLMKIVTNCSKLIEKPTTVPVEEAKSIAARLYFCQNPDDLLKKMKKRKADEQDSSVPVKK
PKTE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtacaggcaaacgccgtaaatatcccctcttcaaagaagggcatacctggg
aaacctcctaattacaaaagacttagtgacgatgacctttttagacattcatctcagtat
cgtttctggtcattcacacctgaacaactggaacagaggcgtatagaagttaacgcacaa
gcagttcaatccattgaacaagatttgcgtaatttcatcgatgccaggagtactgagcta
aatgaagaagaaatcaagactattgaaaacagggccgtgccggtcaatatggaggaggag
ttgaagctagtaaatttgtacgcaaagaaagtacagacgattgctcagcgtctcaattta
cctacggagatcgtcgcgacttccataacgttctttagacgattttatctggaaaactcc
gtcatgaagatcgaacccaaagcgatcgtcctgactaccatatttctagcatgcaaatcg
gaaaactacttcatcggcatagactctttctgtgaaaagactagaggggataaggagcaa
gttttgaaatacgagtttccccttctcgaaagtcttaaattctcactactaagtcatcat
ccatatagaccgctgcatggatttttcctggatatacaggctgtacttcacggaaaggtt
gatttgagttatatgggtcacatatatgatagatgtaagaaacgaataacagatgctttg
ctaacagatgcggtctatttttactccccacctcaaatcacacttgcggtactgatgcta
gaagatgaggctctcactacaagatacctggaactgaaatttcacggcaacgatactaat
caaggtaatgcagaggacgaagcaagtagggggaacggtaatgtcactattcagctcgat
aagttgatgaagatcgtcacaaattgctcaaaacttatcgagaaaccaactactgttcca
gtagaggaagcaaaatcgatagcggccagactatatttctgtcaaaatcctgacgattta
ttgaagaagatgaagaagagaaaagctgatgaacaagattcctcagtacctgtgaagaag
cccaaaacagaataa

DBGET integrated database retrieval system