KEGG   Torulaspora delbrueckii: TDEL_0C03330Help
Entry
TDEL_0C03330      CDS       T02236                                 

Gene name
TDEL0C03330
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TDEL_0C03330 (TDEL0C03330)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TDEL_0C03330 (TDEL0C03330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:592158..592871
Genome map
AA seq 237 aa AA seqDB search
MSTQRSVIPLESNPEVFTQFAHNLGLDESHEFVDIYSLTDPDLLGFVPRPVKALILLFPL
NEVFESEKNLRTDDNTELKTNDGNQPVWFKQTIRNACGLYGILHSLANNDELLKTDSPLL
NFLKSNQRDNGQYADEITDDFVVSLSEDNAERFRQGQTQAPENGEVDLHFITFVEHNGKI
YELDGRRPTGAKLLGVTQDKDLLGQSLVSDRVQWYMDNADEESKLNFSLLGLAQPWN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccagcgttctgtcatacctctagaatctaaccctgaggtgtttactcaattt
gcgcacaatttgggcctagatgaatcgcatgaattcgttgatatatactcacttactgat
ccagatctgttgggattcgttcctagaccagtgaaagcccttattctacttttccctctg
aatgaagtcttcgagtcagaaaagaatttacgtactgatgacaacactgagttgaagacc
aatgacggaaatcaaccagtctggttcaaacagactattagaaacgcctgcggattatac
ggcatacttcactccctagctaacaacgatgagctcctgaaaactgattctcctctgctg
aatttccttaaatcgaaccaaagggacaatggacagtatgcggatgagataacggacgat
ttcgtcgtttcactgagcgaagataatgcagagagattccgtcaaggtcaaacacaggct
ccagaaaatggtgaggttgatctacacttcattacctttgtcgagcataacggtaaaatt
tacgagctggatggtagaagacctactggcgctaagcttctaggtgtcacacaggacaag
gatcttttgggacaaagcttggtttccgatagagtacagtggtacatggacaatgccgat
gaggagagcaaactcaatttttctcttctaggactcgctcagccctggaattag

DBGET integrated database retrieval system