KEGG   Torulaspora delbrueckii: TDEL_0C03590Help
Entry
TDEL_0C03590      CDS       T02236                                 

Gene name
TDEL0C03590
Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(629320..630372)
Genome map
AA seq 350 aa AA seqDB search
MATIFTSTVSKRSLYLLGGAVAAASLASTVALNNHGNNYKNFRNNNKTNFGKGALLGAAP
ALHAAQCEKGRTIEDFQKVYNAIAAKLREEDEYDNYIGYGPILLRLSWHVSGTYDKNDNS
GGSFGGTYRFKKEADDPSNMGLQNAAKFLEPIAKEFPWISHGDLYTLGGVTAIQEMQGPK
IPWRPGRVDADEKETPENGRLPDATQGSDYVRKYFGRFGFTDQEIVALIGAHSLGKTHLK
NSGFEGPWGASTNVFTNDFFKNLLNENWKKEKNEAGNEQYNSDKGYMMLPTDFSLIQDSK
FKELVEKYANNQDVFFEDFKNAYVKLLENGINFDKLGKPMVFKTLDEQEE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatttttacaagtactgtaagtaaaagatctctctatctattaggtggggca
gttgctgctgccagcttggcttctacagtagcactgaacaaccatgggaataactacaaa
aatttcagaaataataataagaccaattttggtaaaggtgctcttctaggtgctgcacca
gcattgcatgctgctcaatgcgagaagggcagaaccattgaggatttccaaaaggtttac
aatgccattgctgcaaaactgagagaagaagatgaatatgataactatattggttatgga
ccaatcttactgcgtctatcgtggcacgtttccgggacttacgacaagaacgacaattcc
ggtggatcctttggtggtacttatcgtttcaaaaaggaagctgatgatccatccaacatg
ggtttgcaaaatgctgccaaattcctagagccaatcgctaaggaatttccttggatctct
cacggtgatttgtacactttaggtggtgtgactgctattcaggagatgcaaggcccaaag
atcccatggaggcccggtagagtcgatgcagatgagaaggaaactcctgaaaacggtaga
ctcccagatgctactcaaggctcggattacgttagaaagtattttggtagatttggcttc
actgaccaggagattgtggctttgattggcgctcactcgcttggtaaaactcacttgaag
aactcgggatttgaaggtccatggggtgcttctacgaacgtgtttaccaatgatttcttc
aagaacttgttgaatgagaactggaaaaaggaaaagaacgaggctggtaatgaacaatac
aactccgataagggctacatgatgttaccaacagacttctcattaattcaggattcgaaa
tttaaagaattggtagaaaaatacgccaacaaccaagatgtgttttttgaagatttcaag
aacgcctatgtcaaactacttgaaaatggtatcaatttcgataaattgggtaaaccaatg
gttttcaagactttggatgaacaggaagaataa

DBGET integrated database retrieval system