KEGG   Torulaspora delbrueckii: TDEL_0C04800Help
Entry
TDEL_0C04800      CDS       T02236                                 

Gene name
TDEL0C04800
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TDEL_0C04800 (TDEL0C04800)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   TDEL_0C04800 (TDEL0C04800)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:866157..867467
Genome map
AA seq 436 aa AA seqDB search
MPNILNNNDDIVNRQQRVNKSDWKYYRYKPSSDRIKGLLNLQMDKTHLSQRESESRTVYE
SAKFSLPARYEVIQTLGKGSYGTVCSVKDRLNPQNQYPIAVKKITNIFYREILLKRAIRE
LKFMIFFKGHKNIVNLLDLEIVSDKPYDGLYCYQELIDYDLAKVIHSSVQLSDFHIKHLF
YQILCGLKYIHSAEVIHRDLKPGNILCTLNGCLKICDFGLARGLAPQFFTSKDNYHDITN
YVATRWYRAPELILSEKAYDKSIDMWSTGCILAEFYARKPLFMGKDSMHQVHEIVKVLGA
PSKEILVDYGSLKAWNTYHNLSGSSPTVSWQELYPFAAIEALDLIDNLLKWHPKKRFTVE
QALEHPFLGAVRNLDDEPVCPWGPFDFSYEYQLHSMPRLREFLIHEVSMFREERLRRNIT
KSKAVGDIKIVGDLQL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattttaaataataacgatgatattgtgaatcgacaacaaagagttaacaaa
tcggattggaaatactatagatataagccgagctctgatcgtattaaaggtttgctgaat
ttgcaaatggataaaactcatttgagccagcgggaatcagagtctcgtacagtgtacgag
agcgctaaattctctttacccgcgagatatgaagttatccaaaccttggggaaaggatct
tatgggaccgtttgctccgtcaaggatcgattaaatccacaaaatcagtatccaattgcc
gttaagaagataaccaacattttttatcgagaaattcttctgaagagggcaataagggaa
ttgaaatttatgattttcttcaaaggccacaagaatatcgttaatttacttgaccttgaa
atcgtctcagacaagccatatgatggactttattgttatcaggagcttatcgactacgat
ttggctaaagtaattcattcttcagttcaactctcagattttcatataaagcacctattc
tatcagattttatgtggtttgaaatatattcatagtgctgaagttattcacagggatttg
aaaccaggtaatatcctctgtacgttaaatggttgtttaaaaatctgtgattttggctta
gcaagagggttggctccacaattcttcacttcaaaagataactatcacgatataaccaat
tacgtggcaactcgttggtatagggccccggagttgattctctcggagaaagcttatgac
aaatcaattgatatgtggtccactggctgtatcttggcagaattttacgcaagaaaaccg
ctatttatgggcaaagactctatgcaccaagttcatgagattgttaaagttttgggagct
ccatcaaaggaaattctcgtcgactacggatcattgaaggcatggaacacctaccataat
ttgagtggatcatctccaacagtttcttggcaagagttgtatccctttgccgcaattgaa
gcattagatttgatcgataatttattgaaatggcatccgaagaaaaggtttactgtagag
caggctttggagcatccctttttaggtgctgttcgaaatctagatgatgaaccagtctgt
ccttggggtccgtttgatttctcctacgaatatcagttacactctatgcccaggcttaga
gagtttttaatacacgaagtctcaatgttcagagaagagaggctgagacgtaatataaca
aaatcaaaagccgttggagacataaaaatcgtgggggacctgcagttgtga

DBGET integrated database retrieval system