KEGG   Torulaspora delbrueckii: TDEL_0C05040Help
Entry
TDEL_0C05040      CDS       T02236                                 

Gene name
TDEL0C05040
Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(901798..903162)
Genome map
AA seq 454 aa AA seqDB search
MTRLTIATSEFQSQVSDLLPCNSYKRSQLTHALIRSLSLLERFDEVLTSPVCFKEDMLQF
HSAAYIDAILDEKLNTVLPFEEDEQKWSQLAELAASWVNHGTDTQWHESRYELLSKFKKI
KDDLPPKPRKRSSLEALLHADEDDDEKSNVSTGQRDLKQFNLEGDCPLFSFIPMYCQVIT
GATLMLADKVIKGERSIGINWDGGRHHAFKQKASGFCYVNDIVLLIQKLRRKGFQKISYI
DFDLHHGDGVEKAFQFSSNVQTISLHLFEVGFFPGTGNLSESDKRRNVVNIPLLHGLDDT
SLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDC
PVILLGGGGYNVTLMSRLYTYLTWKIVRTYCSDSSSICEIDDDALVPEHEFIDVYADEEY
KFWAYEQEGGLRKKQLRNDNDKDLITSLKSHYNL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggctgacaatcgctacttccgagttccaatctcaagtttctgatctgctgcca
tgcaacagctataaaagatcgcaattgactcatgctctgattaggagtctttctttattg
gaacggttcgatgaggttctaacgtcaccagtatgctttaaagaagacatgctgcaattc
cactcagcagcatacattgatgctatactggacgagaaactaaatactgtgttgcctttt
gaagaagacgagcaaaaatggtctcaactagcagaattagccgcctcttgggtcaatcat
ggcactgatactcaatggcatgaatctcgttatgaactgctctctaagttcaaaaagatc
aaggatgacttacctcctaaacctcgaaagaggtcatctctagaggctttgctacatgcc
gacgaagacgatgacgagaagagcaatgtgtcgactggtcaaagagatctgaagcaattc
aacctggagggcgattgccctctgttttcattcatcccaatgtactgccaagtcattact
ggggcgactctgatgttagctgacaaggttattaagggagaacggtcaattgggatcaac
tgggatggcggcaggcatcatgcgttcaaacagaaagccagcggtttttgttacgtaaat
gacattgttctactaattcagaagcttagaaggaaaggatttcagaagataagctacata
gacttcgatttacatcatggcgatggtgttgagaaggcctttcaattctcttcaaatgta
cagaccatttcattacacctgtttgaggtagggttctttccaggcacaggtaatctaagc
gagtctgacaagcgaagaaacgtggtgaatataccactactacatggactcgatgatact
tccttagagcagttaatagaacaaattgtgaagcctgtcatcgagagacatgaacccgac
gtattagtcattcagtgtggaggtgatggtttgatgggagacgggtttaatgagtggcaa
ctatccattaggggactagccaaatgcatcacagaactaataaataataccaaagattgc
ccagtgatactgctaggtggcgggggctacaatgttaccttgatgagtagactctatacc
tatctcacatggaaaatagtgcgaacctattgctcagattcttcatccatatgcgagatc
gacgacgatgctttagttccagaacatgaatttattgatgtctatgctgatgaagagtac
aaattctgggcctacgaacaagaaggaggtctacgaaagaagcaattgaggaacgacaat
gacaaagatttaattacatcattgaagagtcattataacctgtag

DBGET integrated database retrieval system