KEGG   Torulaspora delbrueckii: TDEL_0C05630Help
Entry
TDEL_0C05630      CDS       T02236                                 

Gene name
TDEL0C05630
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tdl  Torulaspora delbrueckii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TDEL_0C05630 (TDEL0C05630)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TDEL_0C05630 (TDEL0C05630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1004320..1005342
Genome map
AA seq 340 aa AA seqDB search
MGITVIGSLNYDLVTYTDRLPFAGETFRANSFETHAGGKGLNQTIAIAKLKQAGSDYSVR
MVGNVGADSFGHELINLLAANEVEVSTIKTVEDKSTGVATIIVEEMNGGQNRILLSEGAN
GSTVYNSDELSEIFSKIKEKDIEDDRHFVVFQHEIPDPCSIMKWLKENYPSFEVIFNPSP
CKPLAREYWRNVDVLIINEIEALQIAQAIFSKEIYDGYKTLVSENFVEGYRKICQEFQQN
LISNINDAAVVVTLGSQGSLYCSKNHKCVGYTPSLKGINVVDTTGAGDTFLGSLVTQLYY
NVRLEDAIKFSTKASSLTIQRKGAAESIPTYSEVAKVVRT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcacagttataggatcgctcaattatgacttggtaacgtatacggatcgttta
ccttttgctggagagacttttagagctaacagtttcgaaacacatgctggaggtaaagga
ttgaatcaaacgatagcaattgccaaattgaaacaagcaggatctgattattctgtaaga
atggtcggaaatgttggtgctgactcatttggacacgagctaataaatttactggccgct
aatgaggttgaggttagtacgatcaagactgtcgaggacaaaagtactggtgtagctact
attatagtggaggaaatgaatggagggcaaaacagaattcttctgagtgaaggtgcaaac
gggagtactgtgtacaattctgatgagttgtcagagattttttcaaaaattaaggagaag
gatattgaggatgatcgacactttgtggtcttccaacatgaaatcccggacccatgttca
atcatgaaatggctcaaagaaaactatcctagttttgaagttattttcaatccatcacca
tgcaagcctcttgctcgggaatattggagaaatgtcgatgttctgatcattaacgagatt
gaagctctacagatcgcacaggctatcttctccaaagagatatacgatggatacaagact
ctagtcagcgagaattttgtggagggatatcggaagatatgtcaggagttccagcaaaat
ctcattagtaatatcaatgacgctgctgtggtggtgacactgggatcacagggatcgctg
tattgttcaaaaaatcacaaatgtgtcgggtacacgccttctctcaaagggatcaatgtc
gttgatacaactggtgcgggagacacattcttgggatctctagtgacccagctgtattat
aacgtgcgtttagaagacgctattaagttttccactaaagctagttcactgacaattcaa
agaaagggtgccgctgaaagcataccaacttactctgaagtagcaaaagttgtcagaact
tga

DBGET integrated database retrieval system