KEGG   Torulaspora delbrueckii: TDEL_0C06720Help
Entry
TDEL_0C06720      CDS       T02236                                 

Gene name
TDEL0C06720
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TDEL_0C06720 (TDEL0C06720)
Enzymes [BR:tdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TDEL_0C06720 (TDEL0C06720)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TDEL_0C06720 (TDEL0C06720)
  Exosomal proteins of colorectal cancer cells
   TDEL_0C06720 (TDEL0C06720)
  Exosomal proteins of bladder cancer cells
   TDEL_0C06720 (TDEL0C06720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1227339..1228910
Genome map
AA seq 523 aa AA seqDB search
MLLNKKTLFHFATLLTSAVGVLAQEGAVAPEDSAVVKLTSETFEQFIKDNSLALVEFFAP
WCGHCKTLGPQFVKAADALQEKDIPLAQVDCTEQQELCMSQGIRGYPSLKTFKDNDISNP
RDYEGARSADAIINYMIKQTLPVVQNVESEKALNEIVQNATVPVIISNGASKLNETFYQI
ANKFSDEYIFASCPELKSELSLQLPGVAEPIVFNGDVKKAETDAEVLESWIKVEALPYFG
EVNGSTFSSYLESGIPLAYFFYTDDEELKEYAPFFTELAKEHRGKLNFASLDSRKFGRHA
ESLNMREQFPLFAVHNVTSNLKYGLPQLAQEEFEKLTDTVKLETKHISKLVKDLLTGKAE
PIVKSEEIPEVQESNVYKIVGKTHEDLINDNKKDVLVKYYAPWCGHCKRLAPIYEELANI
LASDKSAAKNFIIGEVDATLNDIQDVMIEGYPTIILYPAGKDAEPVLFNSQRDLDSFLSF
LEENAGNKVDTAVVREAYEKELAAKEEAEDEEEDAEETAHDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaacaagaagactttgttccattttgccacccttttaacttccgcagttggt
gttctggctcaggaaggtgctgttgcaccagaagactctgccgttgtcaagttaacttct
gaaacgtttgaacagtttatcaaagacaactctttggctttggttgaattttttgcccca
tggtgtggtcattgtaaaaccttgggccctcaatttgtgaaggccgctgatgctttgcag
gaaaaggacattcctttggctcaggttgactgtactgaacagcaagagctatgtatgtct
caaggtatcagaggttatccatctttgaagactttcaaggataatgacatcagcaaccct
agggactatgaaggtgcaagatctgctgatgctatcattaactacatgattaagcaaact
ttacctgtagtgcagaatgtcgagtccgagaaagctttgaatgaaattgtacaaaacgcc
actgttccagtcattatctccaatggtgcttctaaattgaatgaaactttctaccaaatc
gctaacaagttctccgacgaatatatttttgcctcttgtccagaattgaaatccgagtta
tctcttcagttgcctggtgtcgctgaaccaattgttttcaacggtgacgtcaagaaggct
gaaaccgatgctgaagtcttggaaagctggattaaggtcgaagctttaccatactttggt
gaagttaacggcagcaccttctcctcttacttggaaagcggtattcctttggcttacttc
ttttacactgatgatgaagaattgaaggaatacgctccattcttcactgaactcgctaag
gaacaccgtggtaaattgaactttgctagcttggactctagaaagttcggtagacatgct
gaaagcttgaacatgcgtgaacaattcccattgtttgctgttcacaatgttactagcaac
ttgaaatacggtttgccacaattagcacaagaggagtttgagaaactgaccgataccgtc
aaattggaaaccaagcacatcagcaaattagtcaaggacctactgactggtaaggctgaa
ccaatagtcaagtcggaagagatcccagaagttcaggaatctaacgtttacaagatcgtt
ggtaagacccacgaagatctaattaacgacaacaagaaggacgtcttggtcaaatactac
gctccatggtgtggtcactgtaagagattggctccaatctacgaggagttggctaacatc
ttggcctctgacaagagcgccgcaaagaacttcatcatcggtgaagttgatgccacactt
aacgacatccaagacgtcatgattgagggctacccaaccattatcttgtacccagccggt
aaggatgctgagccagtgttgtttaactcccaaagagacttggactctttcttgtctttc
ctagaggaaaatgctggtaacaaggtcgatacagctgtcgttcgcgaagcttacgagaag
gaattggctgctaaggaagaagccgaagacgaagaggaggatgccgaagagaccgcccac
gatgaattgtga

DBGET integrated database retrieval system