KEGG   Torulaspora delbrueckii: TDEL_0D00380Help
Entry
TDEL_0D00380      CDS       T02236                                 

Gene name
TDEL0D00380
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tdl  Torulaspora delbrueckii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TDEL_0D00380 (TDEL0D00380)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     TDEL_0D00380 (TDEL0D00380)
Glycosyltransferases [BR:tdl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TDEL_0D00380 (TDEL0D00380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:65435..67726
Genome map
AA seq 763 aa AA seqDB search
MGPRKRGSTPVATGTAGKDVDDPSLKYTKKGPDYELLSEKWLMRSAPDSPKEYRIWLYVV
TAIAFVARFYLLWYPKEVVFDEVHFGKFASYYLERAFFFDVHPPFAKMMIAFIGWLVGYD
GEFKFDDIGDSYEQNPAPYLAYRSFNALLGTLTIPVMFNTLKELNFKAVTCAFASLLVAI
DNAHVTETRLILLDAILIFAIALTVYCYVRFYKAQLRAPFSWSWYGWLYATGMSLSFVIS
TKYVGVLTYATIGTMVAINLWQLTDVRAGLSLKKLFSHVFKRLNGLILAPFVVYLFWFWI
HFAILIKSGTGDAFMSGEFQETLGDSPLAKESKQVNYYDIVTIKHKETHVLLHSHWATYP
QRYEDGRISSQGQQVTGYSVQDPNNEWEILPVKELSSKSGQPLYLNEAFRLRHVATNSYL
RAHDVASPFYPTNEEITTVTEEEANGEAYQQTLFTFQSLQKKDTETIVKTKGTLFRIFHV
DTAVVLWTHNDVYLPEWGFGQQEVNGNKKLTESSNNWYVDEIVNIDEERKAYVPKEIKQL
SFFTKWSELQRLMFEHNNKLSSEHPFASQPYSWPGSLSGVSFWTNDAERKQIYFIGNIIG
WWLQVISLGIYVGIIITDLVTRKRAYYALGRITREKLYGPLMYFFVGWAWHYFPFYLMGR
QKFLHHYLPAHLIASLFTAALWETIFSDCKSLDPEKDEDAPGVHYQHNPEIYTKYLWVAF
GVMSLGVIVFFLYFSPFVYGNVSLTPEQVVRRQWMNIQLSFAK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctagaaaacgcggttccactccagttgcgaccggtacagccgggaaggatgtt
gatgatcctagtttgaagtacaccaagaaaggtcccgattatgagcttctgagcgaaaag
tggctaatgagatctgctccagatagtccaaaagagtaccggatttggctctatgtggtc
acagcaattgcatttgttgcaagattttatctattgtggtatccaaaggaagtggtattt
gatgaagttcattttggtaaatttgcttcctactacctggaaagagctttcttctttgat
gtgcatcctccatttgcgaagatgatgattgccttcattggttggttagtcggttacgat
ggggagttcaaatttgacgatattggggacagttatgagcagaacccggcaccttacttg
gcttacagatctttcaatgctttgttaggtactttgactatccccgtaatgttcaatact
ttgaaagaattgaattttaaggctgttacttgtgcatttgcttcgttgctcgtggctatc
gacaatgcacatgtcacagagacaagattgatccttttggatgccattttgatcttcgcc
attgcacttactgtttattgctatgtgaggttttataaagctcaattgcgggctccattc
tcctggagttggtatggctggctttacgcaactggtatgtcgttgtccttcgtcatctcg
acaaagtacgtcggtgtgctgacttatgctaccatcggtacgatggttgccattaacttg
tggcaattgactgatgtgcgtgctggcttgagcttaaaaaaactgttctcccatgtattc
aagagattaaacggtcttatcttagcacctttcgtggtttatttattttggttctggatc
cattttgccattctaatcaaatccggtactggtgatgcctttatgtccggtgagttccag
gaaaccttaggcgactctccactggctaaggagtccaaacaggtcaactattatgacatt
gtcaccattaaacacaaagaaacccatgtgctattgcactcacattgggccacttaccca
caacgttacgaagatggccgtatttcatctcaaggtcaacaggtcaccggttactctgtg
caagacccaaacaacgagtgggagattcttcctgtcaaggaattatcttccaaaagcggc
cagccactctacttgaatgaagcttttaggctaaggcatgtggctacgaactcgtatctg
cgggctcacgacgttgcatcacctttttacccaaccaatgaagagattactactgtcacc
gaagaggaagccaacggtgaagcttatcagcagaccttgttcactttccaatccttgcaa
aagaaggatacagaaaccatcgtcaagaccaagggcacactcttccgtattttccatgtt
gacacagcagtcgtattgtggacccataacgacgtttatttacctgaatggggctttggt
caacaagaagtgaatggtaataagaaactaacggaaagctccaacaactggtatgtggat
gaaatcgtaaacatagatgaagagagaaaggcctacgttccaaaggaaataaagcaatta
tctttctttactaaatggtctgagcttcaaagactaatgtttgaacacaataacaaattg
tcatcagaacatccatttgcttctcaaccttactcatggccgggcagtttgagtggtgtt
tccttctggacaaacgacgctgaaaggaagcaaatttattttatcggtaatatcatcggt
tggtggttacaggtgatctcattggggatttatgttgggatcatcattaccgacttggtc
actaggaagcgtgcgtactatgcgttgggaaggatcaccagggaaaaattgtacggtcca
ttgatgtattttttcgttggttgggcatggcactacttcccattctatttaatgggtcgt
caaaaattcttgcatcactacttgcctgcacatttgatcgcatcgctgttcactgcagca
ctatgggaaactatcttcagcgactgcaaatctttggatccagagaaggatgaggatgcc
ccaggtgtccactaccaacacaacccagagatatataccaaatatttgtgggtggcattc
ggtgttatgtcacttggtgtcatcgtgttcttcctatacttctctccatttgtctacggt
aacgtcagtctaaccccagaacaagttgtgagaagacaatggatgaatatccaactgagc
tttgccaagtga

DBGET integrated database retrieval system