KEGG   Torulaspora delbrueckii: TDEL_0D01000Help
Entry
TDEL_0D01000      CDS       T02236                                 

Gene name
TDEL0D01000
Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TDEL_0D01000 (TDEL0D01000)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TDEL_0D01000 (TDEL0D01000)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(179414..184342)
Genome map
AA seq 1642 aa AA seqDB search
MNSQVSSNDSRRSSEPQLPQLPQQLNVSHNNEGWMAALFNFTWVISYFLVGTTVFITKWS
TYLMTLCLLRVPRWVFIKTNKQHLTISFPTFLVLATLTAYVIYCIMKGNVFAQYKRLIPD
EAEDELNPELLKKSSILRNSQSKSTNKLIEGKERTGNKYSGYGDPDDDSYRTSHLDQFLS
AIKIFGYLEKPVFHDLTKNMRTQKMDEGEILLLDSSIGFAIVVEGTLQIYHKVEQEDTLD
GDKNVSSKNDEGFETLECLKDTESPIDYSHIEDFDDFTNDEQTDASAYIRLKNGFGKFQL
LNTVKPGNPVSSLVNILNLFTEPSRNMDWENLASRSPSVDVSAFPSPFNTFSANMKDELP
VENHSNLSSVASPSSLNHCTTPDNLEISDDNLPSVAIPKVVARAATDCTIAIIPPQAFAN
LTAKYPQSASHIIQMILTRLYRVTFQTANDYLGLTKEIMDMEVLLNKTVSYDLPFYLKEA
VVRMADDEHSSDGLDIKSSLNLDNRESSSLAKESRANVSKTVERPKLRSPNNYASTASLR
GSRHVVLGSRDHLNPGDLLSSVPLSRKESSGTGGSKVQDKLVTPISSPLSPKNYQNSASL
YSKTSNQASHYSTTSSMLSRGVNSLANKRPSNNGSSTSGFHPALRDEDLKTRSFSAAQEE
TEESSLRMALVEAMFTYLGISRENMVAPPTPPSTSIDGESSSRNPSSTNLRHNSIMTSSG
LFLTPYATPSSTSATSANLRILPSDYAITSQKQKPKKRKVYREEVSPNLDYESAKSEFSQ
GIEVQFFKQGSVLVEQNSKGKGLFYVISGKIDVTVYSRRPERKINSNRRDKAEDHKVENL
LFTVGAGGVAGYLSSLIGYKSFVNLKARTDVCLGFLPNRVLERLCSKYFMIYLRIAETLT
SLLSPKMLKFDYAVEWIQLSASDTLFKQGDPANGIYLVLNGRLRQLQRKEEEKSADDEAN
LYERDDTDGGDTDRLETTGELAQGESFGEVEVLTAMDRVGTIVAVRDSELARIPRSLFEL
LALEHPSIMIRVSRLVARKILSNGNGQSGSSKNDKGPNFDFSDPISQTRPTNVNYNHNSP
QHHTTPGTITYRTLTILPITSGLPVEEVAMKLVHAFKQVGRSTIGLNQRTALTHLGRHAF
DRLAKLKKSGYFAELEEMYETVVYIADTPVNSSWTKTCIAQADCVLLLANAAASPEIGEY
EKLLLNSRTTARTELIMLHSDRFVDPGSTHKWLRYRNWVDSHHHIQFAVDPLGVEGDTKH
AGLNSGAFGLMDKLIQGEFSKKTQQNISKLVPDSIKSRMENFSSKFSDRKRHYYSPAHKN
DFLRLARILSGQAIGLVLGGGGARGISHLGFLQAIEEQGIPIDMIGGTSIGSFIGGLYAK
DYDLVPIYGRVKKFAGRIASIWRMMTDLTWPVTSYTTGHEFNRGVWKAFGDARIEDFWLQ
YYCNSTNITESVQEIHSFGYAWRYIRASMSLAGLLPPLEDRGSMLLDGGYLDNLPVWEMK
ARGCNTIFAVDVGSVDDRSPMDYGDSLNGFWIVLNRWNPFSAHPNIPNMAEIQMRLGYVA
SVNALERAKRTPGVLYARPPIEEYATLDFGKFREIYEIGAQYGHVFLDELQRQNKMPYIP
GSKTNALEEDVPEFLLHRRNSI
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgcaagtttcttcgaatgattccagacgctcttcagaaccgcaattacctcaa
ttgccccaacagcttaacgtgtcccacaataatgaaggttggatggccgccttattcaac
ttcacttgggtcatcagttactttctcgttggaaccacagtgtttatcaccaaatggtct
acctatttaatgactctatgcctactgcgagttccaagatgggtattcatcaagactaat
aaacagcatctaacgatatcgtttccgacctttttggttctagccactttgaccgcatat
gtcatctattgcatcatgaagggcaatgtgtttgctcaatacaagcgattgattcccgat
gaagctgaagatgagttgaacccagagctgttaaagaaaagttcaatactacgaaacagt
caaagtaaatcaactaataagttgatcgagggaaaggagaggaccggtaacaagtacagt
ggatatggcgatcccgacgatgactcctataggacatcccatttggatcaatttttaagt
gcaatcaaaatatttggttacctagagaaaccggtattccacgatttaacgaagaacatg
agaactcaaaagatggatgaaggtgaaatactactgctagatagttctattggatttgcc
atagtcgttgagggtacattacaaatatatcataaggtagaacaggaagatacgttggac
ggtgacaaaaatgtatcaagcaagaatgacgaggggtttgagactttagagtgtttgaaa
gatacagagtcacctattgactatagccatatcgaggattttgatgatttcacaaacgat
gaacaaacggatgcgtctgcctatatccgcttaaagaatgggtttggtaagtttcaactt
ctgaatactgtgaaaccaggtaacccagtatcgtccttggtcaatatcctaaaccttttc
acggaaccatctcgcaatatggactgggaaaatttagctagtcgctcaccgtcagtcgat
gtcagtgctttcccatctccattcaatacgttttctgctaacatgaaggatgaattacca
gtagagaatcacagtaacttatcgtctgttgcatctccaagttctttgaatcattgtact
acaccggataatttagagattagtgatgataatttgccttcagttgctattccaaaagtt
gtagcgcgcgcagcaactgattgcactatcgctattataccacctcaggcgtttgcaaat
ttgacagccaaatatcctcagtcagcctctcacatcatccaaatgattttgactcgattg
tacagagtaacgttccaaactgctaatgattatctgggacttactaaagagattatggat
atggaggttctactgaacaaaacggtttcctatgatttgcccttctacctgaaggaagcg
gtcgtaaggatggccgatgacgagcattcgagtgatggattggatatcaaaagttcactc
aacctcgacaaccgtgagagtagctcccttgcgaaggaatctcgtgctaatgtaagcaag
accgtggagaggccaaaattgagatctccaaataattatgcatcaacagcatctttgcgt
ggatcgagacatgttgttttaggctcaagggatcatttgaatcctggtgatttactttcg
agtgtaccactatccaggaaagaatcttcaggaacgggaggctcgaaagtgcaagacaaa
ttggtcactccaatatcgtctccattatcacctaagaactatcaaaactccgcatcattg
tactccaaaacctctaatcaagcatcgcactattcaaccacatcttcgatgctctctcgt
ggggtgaactcgctcgcgaacaagcgtcccagtaataacgggagctctacttcaggtttt
catccggcattaagagatgaggatttgaaaacaagatcattttctgccgctcaagaagag
accgaggagtcgtctctaagaatggctttggtggaggcaatgtttacttatctcggtata
agcagggaaaacatggtagccccaccaactcctccatcgacatctattgatggtgagagc
agtagcagaaaccccagttcaacaaatttgagacacaacagtatcatgacgtcctcgggc
ctttttctcacaccatatgctacaccatcttccacttctgccacttctgccaacctgaga
attttgcccagtgactatgcaataacgtcacagaaacaaaagccaaagaagagaaaggtt
taccgcgaagaagtatctcccaatcttgattatgagtcagccaaaagcgagttctcccag
ggtattgaagtgcaatttttcaagcaaggctcagtacttgttgaacaaaactctaaaggg
aaaggactattttatgtcatatctggtaaaattgatgtaacagtctactcaagaaggcct
gaaaggaagattaactctaatcgccgagacaaggctgaagaccataaagttgagaacctt
ttgtttaccgtaggagcaggtggtgtagctggttacctatcatccctcattgggtacaaa
tcattcgtcaatttaaaggctaggactgatgtttgtcttggtttcctacccaacagagtt
ctagaaaggttatgcagcaaatatttcatgatttatctgcggattgctgaaactctaaca
agcctcctttcgcccaaaatgttgaagttcgattatgcagtagagtggatccaattgtct
gcctcagacactttattcaaacaaggtgatcccgctaacggtatttatcttgtattgaac
ggtaggttgagacagttgcaaaggaaagaagaggaaaaatcggcagatgacgaagcaaac
ctctatgagagagatgacactgatggtggcgacactgatcgactagaaaccaccggtgaa
ctggctcaaggcgaaagctttggtgaggtggaggttttaactgcgatggatcgtgtagga
actattgttgctgttagagattcggaattggcgcgtataccaagaagtttgtttgagctc
ttggcattggagcacccttctattatgattcgtgtatcccgattggttgcaagaaagata
ttgagtaatggcaacgggcaatccggatcttcgaaaaatgataagggcccaaatttcgac
ttcagtgatccaatttcccagactagaccaacgaatgttaattacaaccataattctcca
cagcatcataccacccctggaacgataacctacagaacgctaacgattcttcccataact
tctggattacctgttgaagaagtcgctatgaagctagtccatgcgttcaagcaggtaggg
cgttctaccattgggctaaatcagagaacagcactaacccaccttggtcggcatgcattc
gatagactggcgaagttaaagaaaagtggttattttgctgagttggaagagatgtacgaa
acggtggtgtatattgcggatacgcctgtgaactcaagttggactaaaacgtgtattgct
caggcagattgtgtgctattgttggcgaatgctgctgcttcaccagagattggagaatat
gaaaagcttttgctgaattcaagaactacagcaagaactgagctcatcatgctacattca
gatagatttgttgacccaggatcgacacacaagtggttgagatatcgtaattgggtggat
tcacaccaccatatacaattcgctgtggatcctctaggggttgaaggcgacaccaaacat
gctggcctgaatagtggcgcctttggcttgatggataagttaattcaaggtgagtttagt
aagaagacgcaacaaaatatttcgaagctggtccctgactcgatcaagtcgaggatggag
aatttctcctcgaaatttagtgatagaaagcgtcactattactctcctgctcataagaat
gacttcttacggttggcaagaatcctgtcgggacaagccataggtttggttcttggtggt
ggaggtgctagaggtatcagccacttaggattcttgcaggcgatagaagaacaaggaatt
ccgattgatatgatcggagggacctctataggttcctttatcggtggtttgtacgccaag
gattatgatttagtgccaatttacggtcgtgtcaagaaattcgctggcagaattgcgtca
atctggagaatgatgaccgatttgacatggcccgtaacttcctacaccactggtcatgaa
ttcaatcgaggtgtttggaaggcttttggagatgcaagaattgaggacttctggcttcaa
tactactgtaattcgacgaacatcacggagtcggtgcaagaaatacattcatttggttat
gcttggagatatattagagcttcgatgtctcttgccggtctgttaccgccactagaagac
aggggctcaatgctcttggatggtggttatctggacaatctaccagtctgggagatgaag
gctcgtggttgcaatactattttcgcggtggatgtgggatcagtagacgacagaagtcct
atggattatggagactccttgaatgggttttggattgtgttaaataggtggaaccccttc
tcagcacatccaaacataccaaacatggctgaaattcaaatgcgtctgggttacgtagct
tctgtcaatgcactagagagggctaagagaactcccggtgtgctgtatgcgagacctcca
atcgaagaatatgccacgcttgatttcggtaagttcagagagatttacgaaataggtgcc
caatatggccatgtcttcctcgatgaattacagagacagaacaagatgccctatatccca
ggatcgaagacaaacgccttagaagaggacgtcccagagttcttattgcataggcgtaat
agcatctga

DBGET integrated database retrieval system