KEGG   Torulaspora delbrueckii: TDEL_0D02580Help
Entry
TDEL_0D02580      CDS       T02236                                 

Gene name
TDEL0D02580
Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:493355..497173
Genome map
AA seq 1272 aa AA seqDB search
MLQEDEKSGNVVQEIVSEDSLEAEKRLETPDLMDLGRETDHMVGNTKQADHLDTLTHRDS
GKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVLAYSRRI
SQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSSTLSENTV
YHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDLEFDPTDPRLVDHAIYVSSD
TNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKI
FRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPN
LTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAIQIAFSKTT
WFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFD
ALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSE
TMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVDESVDDDIIE
TAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALS
MLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTI
DASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGNELRR
IGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTT
VNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDIDVSMTKEPSEEYKE
DIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLD
EDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFS
DERLTMAEYGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYS
DSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQ
ELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHR
GEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEH
DIEPLKRIIDRD
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaagaggacgagaagagtggcaatgtagtccaagagattgtctctgaggatagt
ttagaagcagaaaagaggttagagacccctgatttgatggatcttggccgagaaacagac
catatggtgggtaatacgaaacaagccgaccatttggatacgcttacacatagggactca
ggtaaagaagtactgtatcgggaagtctctacaaaatttcctttcaaaacgtctgatcga
ttactagatgatctgattcatgatttggcatttatcaactccaaggaccatgatatacta
tattccgatctgcataatggtatacttaaggctcccgtactagcttattctagaagaata
tcacagttgtatccctactctttcggtactctggtcgaccaaattacattacaaacaagc
ttcgaatacccatcaatttcatgcccagggcataacaagctgaatgtttacatgggagtg
ctgattgatgtgccgcatgactacaagatcaccagtagcaccctttctgagaatacagtt
tatcacttaaaggttactgtgaagactagatctatactggaacacaccaagaaaaaggcc
ggagtcactcattatcattgcattagtgaagcagatctacatcagtttgatcgacaagat
ttggagtttgacccgacagatccgcggttggtggaccatgccatatatgtttcaagtgat
accaataaactggtactcattgaagtcttcttgcctgaattcgacagagaggagaagaca
gaatgctggtccggaacggctattaaaaccagatactcagaggcatgtcagagatttgat
acgctagatccatcggaaattcccacccaagctgactgcattaacactctattgaaaatt
tttaggggtccattgaaccgtcaaaactctgaagagcccttaaagacgataaactctgat
aatgtcgttttgaattcacgtatcaatcccaattggctcacttcaaaatatgggtttgag
ctacatgttgagaaagatgaaagtactggtgaaagctatttcgagtttgaacctcccaac
ctcaccaactacattgaagatagaaaggtcagaaggcttcgggagtcttttattaggaaa
tgtattgaactgatatttctagggaagacagcaattgaactacttggtaaggatgcaaag
actacctccaaagtttaccgaaccttcaacgcaattcaaatcgccttctcgaagacaaca
tggtttaagatgttgggtgagcatagatccatcttttcatttgaatccgcttcgccttta
gacgccaactataacttcattaatctttccgcatgtttttattatattgatcgagacatc
atcaagaactatgaggcacaatgcgcattagatccagaaaacactggcatttatttcgac
gctctaacttacatcgccaatagaaaaggagcctaccaattagtggcttactgtggtaaa
caggatgttgttggtcaggaagctcttgaccaagcattgaaactctttggtatagattcg
aaggacgtagatgttgccactatcgatgattcactactagtctccatttacaaatcggaa
accatggcaaacccaaatgaaaaccgccacactgatctgaaaaacgctttacgattattg
gcgaagtataagaaatccgacaaactcaaattctttgcagattacgagccttataagaac
gtttcacgagcctacgagatattagaagtcgacgaatcggttgacgacgacataattgaa
acagcatattcgataagcattaatgactctccgggtttgaagatagactgtgacagagcg
ctgtacacgattggtgttcgcaaacgaagtctacgtctgttgaattatctgctacagcag
tgccctgatttccagctatattacggtccggggactttattatattcagaagcattgagc
atgttgcaacttaacgaaaacgctggtgatgagacagtccttgaagtgttccaacgcaaa
tggcatcaggagactgcctttgagtccgattatctcttgaagctcaaagctgctttaacc
aaaattggaattgaaagaaattctaaattgattttacattttatagacactggaactatc
gatgctagttgtttgccagctgataactggccaacaggtctgaataatattggtaacact
tgttacctgaactcgctgctgcagtattatttctccctagcaccattaagaaggtacgtg
ctggaatatcaggaaacgatggaacattttaggcatcatactggaaatgagttaagaaga
attggcggcagagaagtcagtgaagctgaggttgaaagatcagttcaatttgtgtatcaa
ctccgtgatcttttccaggcgatgatttattcgaaggaaagatgtgtcactccaagaaag
gaacttgcctatttagcatttgcacccagcaattttgaagttgagtttgagcctaccaca
gtgaatgcccagcatgaagtgtctaaaatagctgaatcgacaaacaacgatattttgatg
tacggaccaacaaataggtcggataacgatcagacaggtcctatagagttggacagtgat
agtgggaatgaagatattgacgtatctatgacaaaagaaccatctgaagagtacaaggag
gatattcccatgagtgacgcagagaaggataatataattagcacttctactcgtgtcgct
aaaattagttctgaccagttagagaatgcattagagatggggagacaacaagatgtcaca
gaatgtattgggaatgttcttttccaactggagagcgcatctgatccaataaatctcgac
gaggacaacgagcaaaacgatttggtcaagcagctcttttacggtaagatcaagcagacg
atcataccgcttgcgaaatcaacagaaatccagaccaagattgaacgatacttatctctc
ttggtcaacatcggagatcatcctaaggacatatacgacgcactcgactcatatttcagt
gatgaacgtctgactatggccgagtatggcgacgtcaaaagaacagttgcggttacagag
ttcccaacgattctacaaatacaaatacaaagagtttactatgatcgtgaaaggttcatg
cctttcaagtcgattgaaccgctccctttcaatgaagtgctgtacatggacagatacagc
gactcacaagaccccaaaatggtagagaagaaaaaggaatcagagcagctgaaagcacaa
ttgtcaagattaaagatacgtcaaaaggaactacttagtgtcaacgaactcggtctttca
cggaaagctgcatatatggagactataaactacctaaagtccgacctgataaagagtcag
gaacttaaaggactcaataacgacttcctcatcgagcaactcaagcaatccatcgcagac
attgatcaagagctcacatcgctgtaccacgatatcgccaagttagagaacactattgac
aagcaattcgaagagttcaaaaaaattggttactcactattcgccgtatttatccacaga
ggcgaagccagttacggtcactactgggtttatatcaaggataggtccaagaacggtacc
tggaggaagtacaacgacgaaaccatcactgaagttcccgagaccgaagtcttcaatttc
acagaggggaatacggcgacgccctacttcctggtatatgttcgccaaggacatgagcat
gatatcgaacctctcaaaagaatcatagaccgcgattga

DBGET integrated database retrieval system