KEGG   Torulaspora delbrueckii: TDEL_0D02620Help
Entry
TDEL_0D02620      CDS       T02236                                 

Gene name
TDEL0D02620
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
tdl  Torulaspora delbrueckii
Brite
Exosome [BR:tdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   TDEL_0D02620 (TDEL0D02620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:join(501856..501868,501937..502304)
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG
LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacactgataaccttttgggaactggtaaagtcgacaaagccgtc
atatattccagagccggagactcaatttgggcttcttctggtggtttgactttgcaagca
aatgaaatacaagaaattgctcaaggttttgacagtccagttggtttgcagagcaacggt
ttacatattcaaggccaaaaattcatgttgttgagagctgatgatagaagtatttatggt
agacatgatgctgaaggtgtggtgtgtgtaagaacaaagcaaaccatcttgattgcgcac
tatcctccaactgttcaggccggtgaagctacaaagatcgttgaacagttggctgattat
ttgatcagcgtccaatactag

  All links  
No link information was found.   
DBGET integrated database retrieval system