KEGG   Torulaspora delbrueckii: TDEL_0D03340Help
Entry
TDEL_0D03340      CDS       T02236                                 

Gene name
TDEL0D03340
Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tdl  Torulaspora delbrueckii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TDEL_0D03340 (TDEL0D03340)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     TDEL_0D03340 (TDEL0D03340)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(624367..627105)
Genome map
AA seq 912 aa AA seqDB search
MHLPKYENKPFKPPRRIGATEAVIKSSPAKAVGFKRTPSSQAPRSEPKRPKTPYAAGPVE
GTSVACQKIYTLMHRKPTNKKHKTWNGDGYAISKSPDRFTFYDDSGKFIGGSSYAGENEL
TETIFRAGGLEIQLDYEIVSADERREAKVVLQQSNNTSKINGRNSAKSEVSGQKGLSPSP
PIPIPEQFEKKSMPKFKSAFKPSKILTPLSGPLKSVKQKYLPVFDISKIESPVLMNKFAE
ADVDVVVDPLVGKNLRPHQREGVKFMYDCVSGLAKPTGKPPTIDQTTTSLILERDSDISG
CLLADEMGLGKTLMTIALIWTLLKQTPMASQVPCSQSGVPLQGLCSKVLIVCPVTLIANW
KREFGKWLNLSRIGVLTLSPSNTAEKDKYDVRNFLKVQRTYQVLIIGYEKLLTVSNELKS
GKDALDLLVCDEGHRLKNGASKILNILKSLDIGKKVLLSGTPIQNDLNEFYTVVDFINPG
ILGSFSHFKKRFMNPILRARDPANRYNELAVEKGEERSKEMIEITQRFTLRRTNSILAEF
LPPRTDMILFCKPTEAQVSAFKDILQGAQIDLKGLNANSSLSLITLLKKVCNSPSLISSD
SFYHSTLENSKISAKYQRALNSGKLKVLMALLERIRNGTDGEKVVVVSNYTQTLDIIENL
MRSADMKTCRLDGSTQSKRRDSIVTSFNRDPTMFAFLLSAKSGGVGLNLIGASRLILFDN
DWNPSVDLQAMSRIHRDGQKRPCYIYRLITAGCIDEKILQRQLAKHSLSQKFLCDNKAEN
GHADDDLFNKEDLKNLFTVMTDVSSNTHDLICSCEGEGEEITIEDQETRDVTPSPVTANK
LDSWQTALDAQQTIEDYNAKIEKVQTNLIKKCLVGYKHINPRKVDDLLDTVATEAVRRLS
SDVVFVFVKPGE
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaccaaaatatgaaaacaaacctttcaagccaccaagaagaataggcgctaca
gaagccgtcataaaaagctctcctgcaaaagctgtaggcttcaagagaactccatcgtcc
caagctccgcgttcagaacctaagagaccaaagactccatatgctgctggcccagttgaa
ggaacaagtgtagcctgccagaagatttacactttgatgcaccggaaaccaaccaataag
aagcataaaacttggaacggcgatggatacgcaatttccaaaagcccagaccgatttaca
ttttatgatgactctggcaagtttataggtggctcctcttatgctggcgagaatgagctt
actgagaccattttcagggcaggaggcctggagattcaactagactacgagatcgtatcc
gcagacgaacgtcgggaagctaaagttgttttacagcaatccaacaatacctctaagatt
aacgggagaaattcagccaagagtgaggtttcaggtcagaaaggattgtcgccgtcgcct
ccaatccctatacctgagcagttcgagaagaaatcaatgccaaaattcaagtctgcattc
aaaccctcgaagatacttactccattgtccgggccactcaagagtgtcaaacaaaagtac
ttgccagtctttgacatttctaaaattgagagccccgttcttatgaataaattcgctgaa
gcagatgtggatgtagtagttgatcctctagttggcaagaacttacgcccacaccaacgt
gagggtgtgaagtttatgtacgactgtgtttctggtttagcgaagccaacaggcaaaccc
ccgacaatagaccagactacaaccagtctgatattagagcgggactcagatatcagcggt
tgtttgctagcagatgaaatggggttggggaagacactgatgacaatagcactgatctgg
actttactaaagcaaactcccatggcttcgcaagtaccgtgctcacaatcgggcgtgcca
ctgcaagggctgtgcagtaaagtgcttattgtgtgtcctgtcacgttgatcgctaattgg
aaacgcgaatttggaaaatggttaaacctctcgagaattggtgtactaactctgagccca
agtaatacagcagagaaagataagtatgatgttcgaaatttcctcaaagtccagcgaacg
tatcaagttctaatcatcggatatgaaaaactattgactgtttctaatgagcttaaatca
ggaaaggacgctctcgacttactagtttgtgatgaaggccatcggttgaagaacggtgca
tcgaaaattctcaacattctgaagtcacttgatataggtaaaaaggtgttactatcaggg
accccaatacaaaacgatctcaatgagttttatacagtggttgattttattaatcccgga
atattgggatcgttctcacatttcaagaagcgatttatgaatccaatccttcgcgctcga
gatcctgccaatcgatataatgaactggctgttgagaagggtgaagagagatcaaaagaa
atgattgaaattactcagagattcacgttacgaagaacaaactcaattttagccgaattt
ttgccgcccaggacggatatgatactcttttgcaaacccacagaagctcaagtttcggca
tttaaagacatcttgcagggtgcccaaattgatttaaaaggcctgaatgccaactcctca
ttatccttgataacgcttctcaaaaaggtctgcaattctccgtctctcatctccagtgat
tcattctaccactcgacccttgagaattcaaagatatccgcaaagtatcagcgtgcattg
aattcgggcaaactcaaggtactcatggcattacttgaacgcatcagaaatggtactgat
ggtgagaaagttgtcgtagtctcgaattacactcaaacactcgacatcatcgaaaacttg
atgcgatcggcagatatgaaaacctgccgcttagatggctcaacacaaagtaagcgacgt
gattcaattgtcacctcgttcaacagagatccgaccatgtttgcatttcttctaagtgca
aagtctggaggtgtgggcttgaatctcataggcgcgtcaagattaattttatttgacaac
gactggaatccgtcagtggacttacaggcaatgtcccggattcatagagatggtcaaaag
aggccatgctacatataccgcctgattactgctggttgtatcgatgaaaagattttgcaa
agacagcttgcaaaacacagtctaagtcaaaaattcctgtgtgacaataaggcagagaac
ggtcatgccgatgacgacttgtttaacaaagaggatttgaagaatctcttcacagtaatg
accgatgtatcaagcaatacgcatgatttgatatgctcctgcgaaggggaaggagaagaa
attaccattgaagatcaagaaaccagagacgttactccgagccctgtaacggcaaataag
ctggactcctggcaaacagcacttgacgctcagcagactattgaagattataatgctaag
atagaaaaagtccaaacaaatctcataaagaagtgccttgtgggatacaagcacataaat
ccaagaaaagttgatgatttactagatactgtcgcgactgaagctgtacgacggctttca
agtgatgtagtctttgtctttgttaagccaggcgaataa

DBGET integrated database retrieval system