KEGG   Torulaspora delbrueckii: TDEL_0D03380Help
Entry
TDEL_0D03380      CDS       T02236                                 

Gene name
TDEL0D03380
Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:tdl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tdl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tdl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tdl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tdl00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(630256..631002)
Genome map
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGSKKSIKEIVERLNQASLSENVEVVLCPPAPYLEYTASLVQKKQIT
VGAQNTWTKASGAFTGENSVDQVLDVGAKWVILGHSERRTIFHEDDKLIAEKTKFALDQG
AGVIFCIGETLEEKKAGVTLDVCERQLNAAIAEVKDWTNVVVAYEPVWAIGTGLAATAED
AQDIHASLRKLLAAKLGDKVAQQTRILYGGSANGSNVASFKDKADVDGFLVGGASLKPEF
VDIVNSRK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaacttttttcgtcggtggtaacttcaaattgaacggttccaagaaatctatc
aaggaaatcgttgaaagattgaaccaagcttctctatcagagaacgttgaagttgttcta
tgtccacctgctccatacttggaatacaccgcttctttggtccaaaagaagcaaattacc
gtcggtgctcaaaacacctggaccaaggcttctggtgctttcactggtgaaaactctgtt
gaccaagtcctagacgttggtgctaagtgggtcatcctaggtcactccgagagaagaact
atcttccacgaggatgacaagttgatcgctgaaaagaccaagttcgctttggaccaaggt
gctggtgtcatcttctgtatcggtgagactttggaagaaaagaaggctggtgttactcta
gatgtctgtgaaagacaattgaacgctgccattgccgaagtcaaggactggactaacgtt
gttgttgcttacgaaccagtctgggctattggtaccggtttggccgctactgctgaagat
gctcaagacatccacgcttctctaagaaagctattggctgctaagttgggtgacaaggtc
gctcaacagaccagaatcctatacggtggttccgctaacggttccaacgtggcctctttc
aaggacaaggccgatgtcgatggtttcttggtcggtggtgcttctttgaagccagaattc
gttgacattgtcaactccagaaaataa

DBGET integrated database retrieval system