KEGG   Torulaspora delbrueckii: TDEL_0D03540Help
Entry
TDEL_0D03540      CDS       T02236                                 

Gene name
TDEL0D03540
Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tdl  Torulaspora delbrueckii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0D03540 (TDEL0D03540)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TDEL_0D03540 (TDEL0D03540)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TDEL_0D03540 (TDEL0D03540)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TDEL_0D03540 (TDEL0D03540)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     TDEL_0D03540 (TDEL0D03540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:652067..653566
Genome map
AA seq 499 aa AA seqDB search
MLRNLGKNTLTIKRTLMASSVSLSKPVLYNVQDTARVITLNRSKKLNALNGEMCESMFAT
LNEYAKSDCANLIMVKSANQPRSFCAGGDVSFVAESNSNGRAEESAQLFTAEYSLNFQMA
TYQKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGLFPDVGTTFAMPRVIT
LANANGQMALYLALTGDVISGEDAYILGLASHYVKHDSLADLETRLAEIKTLKDGSASDE
SFFTMVDNAIEEFASQLPKDHSFKFSNEKLNVIESCFDISKITSVKQVLQKLDEIIINNS
DASQESKQFASEIKGKLSTKSPTSMQVALRLLQDNSKDNIESALRRDLYTATNFCMAVKN
PESGVEFSEATIHKLIEKQKAPYAWKTKLDDLSPSQITSLVSPKPSMPVSLWRNYANVTW
KQYPHHLKYQLPTETAIMKYITGQDGRNNSLSISKDEVISHFTNFNQTTRGKIGVDKLCR
MVIQRKCTVDDANALKWKN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaaatttgggaaaaaacactttaacgatcaaacgtactctcatggcatccagc
gtgagtttaagcaagccagttctgtacaatgtgcaggatacggcacgtgttataaccttg
aacaggtccaagaagctgaatgctcttaatggggagatgtgtgagtccatgtttgcgact
ctgaacgagtacgccaagagcgattgtgccaatttgattatggtaaaatctgcgaatcag
ccaagatctttctgcgcaggtggtgatgtttccttcgtggccgaaagcaattccaatggt
cgggctgaagagtctgctcagcttttcacagcagagtattcgttgaactttcaaatggcc
acttatcagaagccaatcgtcacttttatggacggtattacaatgggtggaggtgttggt
ttatcgattcatacgccttttaggattgctacagaaaataccaaatgggctatgcctgag
atggatataggtttgttccccgatgtgggtacaacgtttgccatgccaagagttatcacg
ctagctaacgccaacggacaaatggctttgtatttggccttaactggtgatgtgattagc
ggcgaggatgcctatattttgggattggcctcccattatgtcaagcacgatagtttggct
gatttggaaacaaggttggcggaaataaagacactcaaggatggaagcgcatccgatgaa
tcttttttcacaatggttgataatgccattgaagaatttgctagtcagttacccaaggat
catagttttaagttctctaatgagaaactgaatgtgatcgaatcctgcttcgatatcagc
aagatcacttctgtcaaacaagtcttacaaaaattggatgagattatcattaacaattca
gatgcaagccaggaatcaaagcagtttgctagtgaaatcaagggaaagctttcgaccaaa
tcaccaacttctatgcaagtggctctaaggctactgcaagacaattctaaggacaacatc
gaatctgcattgaggagggacctttacaccgctacaaatttttgtatggcagtgaagaat
cctgaatccggtgttgagttttcagaagctacgattcacaaactgattgaaaagcaaaag
gcaccatacgcatggaaaaccaagctcgacgatctttctccatctcaaattacatctcta
gtatccccaaagccttccatgcccgtttcgctgtggagaaactacgcaaatgtcacctgg
aaacagtatccacatcatttgaaataccagttaccgacagagaccgctattatgaaatat
atcacaggtcaggatggccgcaataactcgctctctatctcaaaggacgaagtcatctca
cattttacaaactttaatcaaacgacaagaggtaaaataggtgtcgacaagctttgtaga
atggtcatccaaagaaaatgcacggtcgatgatgcaaacgctttaaagtggaagaattga

DBGET integrated database retrieval system