KEGG   Torulaspora delbrueckii: TDEL_0D03550Help
Entry
TDEL_0D03550      CDS       T02236                                 

Gene name
TDEL0D03550
Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TDEL_0D03550 (TDEL0D03550)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TDEL_0D03550 (TDEL0D03550)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TDEL_0D03550 (TDEL0D03550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:653772..656114
Genome map
AA seq 780 aa AA seqDB search
MTDVSWNEMNVPSVISKDECLYCFETVYNEALKEASALHSLNLCLSCFQPVCHRHLPLHV
QVSEKNCDTAHWQYLNIHKVKRTKVDEDQDMNKSNKKIRLNVVEKSEDEMFETNWSLLKY
NSSTASSEESVSNKDPEINPVVQEKIKQILGSKSQDMVDKTSSWELSVKSCPHTQNFQVP
AVEAKSKDERCNDCGLDQNLWLCLHCGNIGCGREQVGIEGHSHALNHYDKHSTHPLAVKL
GSLSQSSIDLYCYSCNDEVKFENPEAFAQALSKYGIDLKSKLASEKSLVELQVEQNMNWD
FQMTDAQGKELKHLSANKEYGCGLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLD
VLYPSTNMKCQLIKLNNAIKLEPELYPSGIRPRSFKKCIGQAHEEFSSERQQDALEFLSF
FNDTLDKKIFSRSENNPSDLMRYIIENRLQCTKCGKVKYTTDINESMLVPLEENSDSQHS
QSLLDRLVEYFHGEELDFKCPQCKDMVQAIRKPGFKTFPDTLVVNPVRIKLQNWTPVKTA
DDLIIPGLEDPLDTLDLSKFQSSGFNSETESPFPEEEDSHDAEFVPNQACVSQLAEMGFS
PNAITRSLHATGNLETEPAMNWLFAHMEDPDINEPFTPPKAKEADVQIDQEAISSMTAMG
LDAKLCKKALILNNGDVTSSVDWVFNNMDDDGELPQKDTQPAKSHTANLGHSSASPYKLV
AVVCHKGNSAHSGHYVAFIRKSVEQEEKWVLYNDEKIVVAVEDNFEEIRKNGYLYFYSRV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtatcctggaatgagatgaatgttccatcggtcatctctaaggatgagtgc
ctttattgctttgagacggtttacaacgaagccttgaaagaagctagcgctttgcattct
ctgaacctatgtctttcatgcttccaacccgtatgccatagacatttaccacttcatgta
caggttagtgagaagaactgtgacactgctcactggcaatatttaaatatacacaaggtt
aaaagaacaaaagttgatgaggatcaagacatgaacaagagcaacaagaagataaggcta
aatgttgtggaaaaatcagaagacgagatgtttgaaaccaattggtctttgctaaagtat
aattcatcaacggcatcatcagaagagtccgtctctaacaaggatccagaaattaatcct
gtcgtccaggaaaagatcaagcaaattttggggtccaaatcacaggatatggtggataaa
acaagctcatgggaattatcagtgaaatcatgtccccatacccaaaattttcaagttccc
gctgttgaagccaaatcgaaagatgaacgttgcaatgattgcggcttggatcagaatctg
tggctatgtttacactgtggcaacatcggatgtggcagagaacaagttggcattgaaggt
cattcgcatgcactaaaccattatgacaaacactctacgcacccattagctgtcaagttg
ggctcattgagtcaatcttcaatcgatttgtattgttattcttgcaatgacgaagtgaaa
ttcgaaaaccctgaagcgtttgcacaggctttgtccaagtacggtattgatttaaaaagt
aaattggcaagtgaaaagagtttagtggaattgcaagttgaacaaaacatgaactgggat
ttccagatgaccgatgcgcaaggcaaagaattgaaacacctgtcggcaaacaaagagtac
ggttgtggtctcatcaatttgggaaattcctgttacataaactcggtgttgcaatgtttg
ttgaacggaggggttaagacctattcattgagtgcattaggagagtcattccccttagac
gttctttacccaagcacgaatatgaaatgccagctaatcaagctgaacaacgcgattaaa
ttagagcccgagctctacccgagtggtatcaggccaagaagtttcaagaaatgcattggt
caggctcacgaagagtttagcagtgaaagacagcaggatgcgcttgaatttttaagcttc
ttcaatgatacactggataagaaaatattctctcgaagtgaaaacaaccccagtgacctg
atgagatatatcatagaaaacagattgcaatgcacaaaatgtggcaaagtcaaatacact
actgatatcaacgaatcaatgttggtaccattggaagaaaacagtgattcacagcattca
caatctcttctggacagactagtggaatatttccatggtgaagaactagatttcaagtgt
cctcaatgtaaggatatggtacaagctatcagaaaaccaggattcaagactttccctgat
actctagtggtcaaccccgtcagaatcaaacttcaaaattggactccagtgaaaaccgcc
gatgatctgatcattcctggcctggaagatccactagacactttagacctatctaagttt
cagtcctcgggatttaacagtgagacagagtccccattcccagaagaagaggacagccat
gatgctgaatttgtgccaaatcaagcgtgtgtttcccagcttgcagagatggggttttct
cccaatgcaatcactaggtctttgcacgctacaggtaatcttgagacagagccagctatg
aactggctgtttgcgcacatggaagacccggatattaatgagcccttcacaccgcccaag
gcaaaagaagcagacgttcaaattgatcaggaagctatcagcagcatgaccgcgatggga
ttggacgcaaagttgtgcaaaaaagctctgatacttaataatggtgatgtgaccagtagc
gtggactgggtcttcaacaacatggatgacgacggagagctgccacagaaggacacgcaa
ccagcgaagtctcacaccgcgaatctcgggcattcctctgccagcccttacaaacttgtc
gcagtcgtatgccacaaggggaactccgctcactcgggtcattacgttgcattcatcaga
aaatcggtcgagcaagaggagaaatgggtattgtacaacgacgaaaagattgtcgtcgcg
gttgaagataatttcgaagagatcagaaagaacggctatctctacttctactcgagagta
tag

DBGET integrated database retrieval system