KEGG   Torulaspora delbrueckii: TDEL_0D04150Help
Entry
TDEL_0D04150      CDS       T02236                                 

Gene name
TDEL0D04150
Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
tdl  Torulaspora delbrueckii
Brite
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TDEL_0D04150 (TDEL0D04150)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:762423..762821
Genome map
AA seq 132 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTAPGVDSKKRTKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSAASQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagccgaaaagaagccagcctccaaggcaccagctgagaagaaaccagct
gccaagaagaccgctccaggtgttgattctaagaagagaactaaggttagaaaggaaact
tactcttcttacatttacaaagttttgaaacaaactcatccagatactggtatctctcaa
aagtcgatgtctatcttgaactcttttgtgaacgatatctttgaaagaatcgccaccgag
gcttctaaattggctgcctacaacaagaaatctacaatctctgctagagaaatccaaact
gccgttagattgattctacccggtgagctggccaagcatgcagtctcagaaggtactaga
gctgtcaccaagtactcttctgcagcttctcaggcttaa

DBGET integrated database retrieval system