KEGG   Torulaspora delbrueckii: TDEL_0D04600Help
Entry
TDEL_0D04600      CDS       T02236                                 

Gene name
TDEL0D04600
Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    TDEL_0D04600 (TDEL0D04600)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TDEL_0D04600 (TDEL0D04600)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: Other group
  TTK family
   TDEL_0D04600 (TDEL0D04600)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:843530..845917
Genome map
AA seq 795 aa AA seqDB search
MSEYLGIYPSSLERKKSHAAYKDDSDDEKITGPPKLSDFGVALLMEKENMAPSMVRRGEP
SPNSFKRELKTRFGPTNTDYFSGSNNQTSFSQTYVSANSGEPSQSTIFAQSRFNQQPSMT
TMDTNGIKIPASDLETSFGRIKSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKRAS
STNGADMSDLSIGNVQMVQQTDNTPLEEHREVQSPAEIKPDLTKKETRTRDVLDYKSIDF
GDMNPVQYLKLHNLSSSELPKLSKVYFERQREEIHQMALQKSISSREALTNKVQRSFSSI
SSSGNSIRRESSMPLYPRRKLSDTSVSSAAKTSFQSSFSSPLAYPKKNFLIDQPVVTSKP
AADHGKNLTKQYAQREQYTLESSFKKREALANIDINRNSQESLQQPKRFKPIRTQEQLSE
SHLPEPYVNKEEYLNREPPKPRATKRVEILEPKPSQGQSRKNVVKVNDVEYEKVELLGRG
GSSKVYKVRDRSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEH
GVLYLIMECGDHDLSRILNHRAGMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANF
VFVKGILKIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRW
KVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSA
LDTMKACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVE
ELADDVLSRLSDFRL
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaatatttgggcatatacccttcatcgctagaacgaaaaaaatcgcacgcagca
tacaaagatgactctgatgatgaaaagattactggacctcccaagctgagtgattttggc
gttgcactgctcatggagaaagaaaatatggctccgtcaatggtacggaggggtgaaccg
tctcctaacagcttcaaaagagaattaaagacaagattcggaccaacgaatacagattac
ttttctgggagtaataaccagacatctttcagtcagacatatgtctctgcaaactcagga
gagccttcacaatcaactatctttgctcagtccaggttcaatcagcaaccgagtatgaca
acgatggataccaacggaattaagataccagcgagcgacttagagacaagttttggaaga
atcaagagtatgcaacagaatatgagggaagaacttactacaagacacgcgcagaggaga
agccggcggttcttacatggaaccaggatcggcgttttaggaccagctaagcgtgcatca
tctacaaatggtgccgatatgtcagaccttagtattgggaacgttcagatggtacaacaa
actgacaatactccactggaggaacaccgtgaggttcagtcacctgcagagatcaaaccc
gatttaacgaaaaaggaaacgcgaacaagagatgttctagattacaaatcgatcgacttt
ggtgatatgaatccagtacagtacctgaaactgcacaatctatcaagtagcgaactcccg
aaattatcaaaagtatactttgagcgtcaaagagaagagattcaccaaatggctttgcag
aaaagtatatcatctagagaggcactgaccaacaaagtgcagcgatcattttcctcaatt
tcgagttctggaaactctatcaggagagaaagctcaatgcctttatatccgaggaggaag
ctatcagatacctctgtttcatctgcagcaaaaacaagctttcaaagctcattctcttca
ccgcttgcttatcctaagaagaactttttaatcgatcaaccagttgttacttcaaagcca
gcagcagatcatggcaaaaatctcacaaaacagtatgcacaacgtgaacagtatacccta
gaaagctcttttaagaagagagaagcacttgctaacatcgatataaacaggaatagccaa
gagtccttgcagcagcccaagcgattcaagccgatcagaacgcaggagcagcttagcgag
tcgcatttgccagaaccatatgtcaacaaggaggagtatcttaatagagaaccacctaaa
ccacgagctacaaaacgagtggagatactggaacctaaacccagtcaaggacaatcgagg
aaaaacgtggtgaaggttaatgatgtagaatacgaaaaagtggaactattgggtcgaggc
ggctcatccaaggtctacaaagttcgagaccgcagtaataatgtgtatgctttgaaaaga
gtagtttttgatgaatttgacgactcgagtgtaagcgggtttaaaggtgagatcgagctt
ttgaagaaactggaaaatcagaatcgggtggtacagttagttgaccatgagatggagcac
ggtgttttgtatttgataatggaatgcggtgatcatgatttgtctcggattctaaatcat
agagctggaatgcctctcgacatggaatttgtacgatatcatgcgagggaaatgttacgc
tgcgtaaaagtcgtgcatgattctggaatagtccactccgacttgaagccagccaatttt
gtctttgtcaaaggtattttgaaaattatcgactttggtattgctaacgcggttcctgat
cacacggtcaatatataccgtgagaaccagataggaacgccaaactacatggctcccgaa
gccttagttgctatgaactacactcaggatgacgagaaatatcagcaacaaaacagatgg
aaagtaggcaaaccctccgacatatggtcctgcggttgcattatctatcaaatgatttat
ggaagaccgccttatggtggcttccagggtcaaaacaggctacttgccattatgaatccc
gatgtcaaaattatcttctcggacaagacttcaagagatgaaactataccgcgctctgct
ttagatacaatgaaagcatgtttgacgcgtaatccagataaaaggctgactgttgatgaa
gtactcgaaagcaattttttgaagcctctcatggtcacaccatttttcattagggatttg
atcaagaacgcagtaaggtatggcgctgatcagaaagaagtttcaaaagaaaaagtggag
gagctagctgatgatgttttgagtaggttatcagatttcagactatag

DBGET integrated database retrieval system