KEGG   Torulaspora delbrueckii: TDEL_0D04650Help
Entry
TDEL_0D04650      CDS       T02236                                 

Gene name
TDEL0D04650
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tdl  Torulaspora delbrueckii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TDEL_0D04650 (TDEL0D04650)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     TDEL_0D04650 (TDEL0D04650)
Transfer RNA biogenesis [BR:tdl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    TDEL_0D04650 (TDEL0D04650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:853777..854871
Genome map
AA seq 364 aa AA seqDB search
MGFEKELLVATQAVRKASLLTKRIQSEVIAHRNSTTITKSDNSPVTVGDYAAQTIIINAI
KTNFPNDKIVGEESSDGLENAFVSEILREIKENDEVFESKFAGHQEKSLLVNETFPLETI
QNVKTIIDYGDYEGGNKGRVWCLDPIDGTKGFLRGEQFAVCLALIVDGTTQLGVIGCPNL
SLEQYGGKDLPGYEPFGYIFRAVRGNGASYAPAAAATPGTENIWQKAHARELTSTDGMVS
LEGVEKSHSAHDEQSIIKEKLGIKKSLHLDSQVKYCMLAAGLGDVYLRLPIKLEYQEKIW
DHAAGNVIVEEAGGIHTDALQNVPLNFGQGRTLTTKGVIASCGPTNLHKLVVSTSSDVMK
AAKH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgaaaaagagcttttggttgccactcaggccgttcgtaaggcatctttgttg
accaagaggattcaatccgaagtgatcgctcatagaaattcgactacaattaccaaaagt
gataactctccagtcactgttggggattacgcggcccaaaccattattataaatgccatc
aagacaaattttccaaatgacaagatagtaggcgaagagtcctctgatggtttagaaaat
gcatttgtctctgaaatactccgtgaaattaaagaaaatgacgaggttttcgagtccaag
tttgctggtcaccaggagaaaagtctattagtcaatgagacttttccattggaaacaatt
caaaatgtgaaaacaattatcgattatggcgactatgaaggtggtaacaagggccgtgtc
tggtgtctggatcctatcgacgggaccaaaggattccttagaggtgagcaattcgctgtt
tgtctggctttgattgttgatggaactactcaattaggtgtcattggatgtcccaaccta
tcactagaacagtacgggggtaaagatttaccaggttacgaaccttttggatacattttc
cgtgctgtcagaggcaatggggcctcgtacgcaccagctgcagcagctacacctggaaca
gaaaacatctggcaaaaagctcacgcaagagaattaacttccactgacggcatggtatca
ttagaaggtgtagaaaagtcacactctgctcacgacgaacagtccatcatcaaggagaaa
ctcggtatcaaaaaatcactacatctggattctcaggtgaaatattgtatgctagccgca
ggtcttggtgacgtctatctacgtttgcctatcaagctagaatatcaagaaaagatctgg
gaccatgccgctggtaacgttatcgttgaagaagcaggtggtatccacacagacgcattg
caaaatgtcccattaaacttcggccagggtagaacactaaccaccaagggtgtcattgca
tcctgcggacccactaatcttcacaagctagtggtatccacttctagcgacgtaatgaaa
gctgccaaacactga

DBGET integrated database retrieval system