KEGG   Torulaspora delbrueckii: TDEL_0D04650Help
Entry
TDEL_0D04650      CDS       T02236                                 

Gene name
TDEL0D04650
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tdl  Torulaspora delbrueckii
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tdl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:853777..854871
Genome map
AA seq 364 aa AA seqDB search
MGFEKELLVATQAVRKASLLTKRIQSEVIAHRNSTTITKSDNSPVTVGDYAAQTIIINAI
KTNFPNDKIVGEESSDGLENAFVSEILREIKENDEVFESKFAGHQEKSLLVNETFPLETI
QNVKTIIDYGDYEGGNKGRVWCLDPIDGTKGFLRGEQFAVCLALIVDGTTQLGVIGCPNL
SLEQYGGKDLPGYEPFGYIFRAVRGNGASYAPAAAATPGTENIWQKAHARELTSTDGMVS
LEGVEKSHSAHDEQSIIKEKLGIKKSLHLDSQVKYCMLAAGLGDVYLRLPIKLEYQEKIW
DHAAGNVIVEEAGGIHTDALQNVPLNFGQGRTLTTKGVIASCGPTNLHKLVVSTSSDVMK
AAKH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgaaaaagagcttttggttgccactcaggccgttcgtaaggcatctttgttg
accaagaggattcaatccgaagtgatcgctcatagaaattcgactacaattaccaaaagt
gataactctccagtcactgttggggattacgcggcccaaaccattattataaatgccatc
aagacaaattttccaaatgacaagatagtaggcgaagagtcctctgatggtttagaaaat
gcatttgtctctgaaatactccgtgaaattaaagaaaatgacgaggttttcgagtccaag
tttgctggtcaccaggagaaaagtctattagtcaatgagacttttccattggaaacaatt
caaaatgtgaaaacaattatcgattatggcgactatgaaggtggtaacaagggccgtgtc
tggtgtctggatcctatcgacgggaccaaaggattccttagaggtgagcaattcgctgtt
tgtctggctttgattgttgatggaactactcaattaggtgtcattggatgtcccaaccta
tcactagaacagtacgggggtaaagatttaccaggttacgaaccttttggatacattttc
cgtgctgtcagaggcaatggggcctcgtacgcaccagctgcagcagctacacctggaaca
gaaaacatctggcaaaaagctcacgcaagagaattaacttccactgacggcatggtatca
ttagaaggtgtagaaaagtcacactctgctcacgacgaacagtccatcatcaaggagaaa
ctcggtatcaaaaaatcactacatctggattctcaggtgaaatattgtatgctagccgca
ggtcttggtgacgtctatctacgtttgcctatcaagctagaatatcaagaaaagatctgg
gaccatgccgctggtaacgttatcgttgaagaagcaggtggtatccacacagacgcattg
caaaatgtcccattaaacttcggccagggtagaacactaaccaccaagggtgtcattgca
tcctgcggacccactaatcttcacaagctagtggtatccacttctagcgacgtaatgaaa
gctgccaaacactga

DBGET integrated database retrieval system