KEGG   Torulaspora delbrueckii: TDEL_0D05520Help
Entry
TDEL_0D05520      CDS       T02236                                 

Gene name
TDEL0D05520
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tdl  Torulaspora delbrueckii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TDEL_0D05520 (TDEL0D05520)
Enzymes [BR:tdl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TDEL_0D05520 (TDEL0D05520)
Peptidases [BR:tdl01002]
 Cysteine Peptidases
  Family C44
   TDEL_0D05520 (TDEL0D05520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:996468..998189
Genome map
AA seq 573 aa AA seqDB search
MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF
AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI
YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL
KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG
VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR
VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA
ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatctttgctgctcataagcacgaggatgtgcaggcttacaagcaaaaggct
ctacagctttccaagagaattagacatcgtggtccagattggtctggtaacgttcttaga
aacaacaccttgttagttcatgaaagattggctatcgttgggttggattctggggcccag
ccaattactagtccatgtggtaactacactttatgtgttaatggtgaaatttacaaccat
atcaagttgagagaagagttttccgattacaaatttagcactttgagtgattgtgaacct
atcatcccattgtatgaaaaatacgatattgatactccaaaatacttagatggtatgttt
gcttggtgtttgtacgatgccaagcaggaccgtattatcgctgctagagatcctgttggt
atcacgactctctacatgggtcgtaactctttgtctccaaagaccgtgttctttgcatcc
gaattgaaatgtttgaccgatgactgtgacaacatcgtcgctttcccaccgggccacatc
tacgattccaagactgacaagatcacccgttatttcactccagactggttggacgagact
cgtattccatcgaacccagttgattacaaagctattagacactccttggagaaggcagtg
agaaagagactaatggctgaagtcccatacggtgttctattgtccggtggccttgactcc
tctttgattgcatctatcgctgctcgtgaaaccgagaaggctaacgcagagatcgacgcc
cagaagtatgactctgaggacaagcatctagcaggtattgatgattctggtaacttacac
agtgcaggttggtctcgtctacattctttcgccattggtttaccaggtgctccagatcta
aaggctgcttctaaggtggctaagttcattggatctattcatcacgaacacacttttact
ttacaagaaggtctagatgctctagacgacgtcatctggcatttggaaacctacgatgtc
actaccatcagagcctctacaccaatgttcttgttgtcaagaaagatcaaagctcagggt
gttaagatggtcttgtctggtgaaggttccgatgaaatttttggtggctatttgtacttc
gcacaggcaccaaacgctaacgaattccataccgaagctgttaagcgtgttaagaacttg
catttggcagattgtctaagggcaaacaaatccactatggcatggggtctagaggctcgt
gtcccattcctagacagggaattcttacagctgtgcatgaacatcgatccaaaggataag
atgattaacaaagaagaaggccgtatggagaagtacattctaagaaaggctttcgatacc
acggacgaacctgacgttaagccatacctaccagaggaaattctatggagacagaaggaa
caattctccgacggtgttggttactcgtggatcgatggtttgaaggatacagctgagaga
gtcatctccgatgacatctttgcagctccaaaatctgcctggggtgacgatgtaccaacg
actaaagaagccttctggtacagactgaaattcgatgctctcttcccacaaaagaccgca
gcagataccgtcatgagatgggttccaaaggccgactggggttgcgctgaagatccatcc
ggcagattcgcccagattcacgaccaacacgtgaagaattag

DBGET integrated database retrieval system