KEGG   Torulaspora delbrueckii: TDEL_0D05830Help
Entry
TDEL_0D05830      CDS       T02236                                 

Gene name
TDEL0D05830
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
tdl  Torulaspora delbrueckii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TDEL_0D05830 (TDEL0D05830)
Exosome [BR:tdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   TDEL_0D05830 (TDEL0D05830)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1054309..1059168
Genome map
AA seq 1619 aa AA seqDB search
MSDLPIEFTELADLTSLGISPQSLDFRSTTFESDHYVTVRETHDGSNSVAIVDLANGNQV
TRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSFTLDEPVLFWKWLDDETLG
FVTARSIMTSNVFDGNVAGKPQLLTQRHANLNNTQIINIVANKKKDWFAVVGILQDNGRI
AGKIQLYSKQRNISQAIDGHVAMFANILLDGNIAPVQVFVTGNRSVTSSTGELRIIEIDH
DSSLPTTYQKKNVEIFFPPDATNDFPIAVQISEKFGVIYLLTKYGFIHLYELETGMNLFV
NRITAESVFTATSYDSRNGIACINKKGQVLAVEIATSQIVPYILNKLSNVSLALTVASRG
GLPGADDLFQKQFDSLLNQGDYQNAAKIAASSNQLRNQNTINRLKNIQAAPGAISPILLY
FSTLLDKGKLNKYETIELAKPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDVTLALA
CYLRSNAHSKVVSCLAELQQFEKILPYCQKVDYQPNFLVLISSLLRSSPDRASEFAISLL
QNPDTASQLDIEKIADLFFSQNHIQQGTSLLLDALKGDTPDQGHLQTRVLEVNLLHAPQV
ADAILGNNIFSHYDKPTIASLSEKAGLYQRALENYTDIKDIKRCIVHTNALPVDWLVAYF
GKMNVEQSLACLKALMDNNLQANIQIIVQVATKFSDLIGSSILIKLFEEYKATEGLYYYL
ASLVNLTDDKDVVYKYIEAAAKMNQFKEIERVVRDNNVYDPERVKNFLKDARLEDQIPLI
IVCDRFNFVHELVLYLYKSQNMKFIEAYVQQVNPSRAPQVVGALLDVDCDEKFIKDLLQS
VLGQVSINELTNEVEKRNRLKILLPFLEETLAQGVQDQGVYNALAKIYIDSNNAPEKFLR
ENDQYDTIDVGRYCEKRDPYLAYIAYEKGSNDEDLIRITNDNSMYKYQARYLLKRSDPNL
WNMVLAEDNSHRQQLVEAVISVGIPELTDPEPVSLAVQAFMSNGLKLELIELLEKIILEP
SAFSDNVALQGLLLLSAIKYEPSKVGSYIEKLENYDADEIAPLCIENGLNEEAFEIYEKH
NMHSKALKVLVEDIMSLDRAQNFVEKIDTPELWSQLGTAQLDGLRIPAAIESYIKAEDPF
NYENVIEVAEQGGHFEELIPYLTMARKTLKEPKIDGSLILAYAQLGKIHEIENLLSTSNV
ANLEAVGDKLLENQDYKAAKLCYLSVSNYSKLASTLVYLEDYQAAVDTARKASNIRVWKL
VNDACIDKKEFRLAQICGLNLIVHAEELDELVEIYESKGYFEELISLFEAGLGLERAHMG
MFTELAILYSKYEPEKTFEHLKLFWSRINIPKVIRAVEQAHLWNELIFLYAHYDEWDNAA
LTIIEKVTDDLDHAYFKEVIVKVSNLEIYYKAINFYVTEHPSLLVDLLAVLTPRLDIPRT
VRIFSKSDNLPLIKPFLINVLPKNNSVVNQAYHDLMIEEEDYKALQSAVDSYDKFDQLGL
AARLETHEVIFFKKIAALLYRRNKKWSKALSILKEENLWKDAIETAAISGDAKVVEDLLV
YFVENDKKEAFVALLYTAYNLIKYDFVLELSWLHSLGDYTKPYEISVKKEQSDTIEKLL
NT seq 4860 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctaccgattgaatttactgagttggctgatcttacaagtctagggatttcc
cctcaatccttagattttagatcaacaacttttgaaagtgatcattatgtcaccgttaga
gaaacccacgacggatccaactctgttgccattgtcgatctagcaaatgggaatcaagtg
actaggaaaaatatgggtggtgactcagcgatcatgcacccttcacaaatggttatttcc
gtgagagctaacggcactattgttcaaatctttaacttggaaaccaagtcgaagttgaag
tctttcactttggatgaaccagttttgttctggaaatggctcgatgacgaaactttaggt
tttgtgacggcaaggtccattatgacttctaacgttttcgatggtaacgttgcaggcaaa
cctcaattgcttactcaaagacacgccaatttgaacaacactcaaattattaatatcgtc
gcaaacaagaaaaaggattggttcgccgtcgtaggtatcctacaggataacggtcgtatt
gcaggtaagattcaattgtattccaaacagcgtaatatctcacaggctattgatggtcat
gttgcgatgttcgcaaatattctactggatggtaacattgctcccgtacaagtgttcgtc
accggtaacagaagcgtaacttcaagtacaggtgaattgagaattattgaaattgatcat
gacagttccttaccaaccacataccaaaagaagaacgtcgagatattcttcccaccagat
gcaacgaacgatttcccaatcgctgtgcagatctcagagaaattcggggttatctatttg
ttgaccaaatatggtttcattcatctctatgaactagaaactggtatgaatcttttcgtc
aacagaatcacagcagaatctgtgttcacagctacttcttacgacagcagaaacggtatt
gcctgtattaacaagaagggtcaagtgctagccgtggagattgccacttctcaaattgtt
ccatatatcttgaacaagctatccaacgtttctttggcgttgaccgtcgcttccaggggc
ggtttacctggtgcagatgatctattccaaaaacaattcgattctttgctaaaccagggt
gattatcaaaatgctgctaaaattgctgcttcttcaaatcaactaagaaaccaaaatacc
attaacagattaaagaacattcaagcagccccaggtgctatctccccaattctcttgtac
ttctccactcttctggataagggtaaattgaacaagtatgaaactatcgaactggcaaaa
ccagtcttgcaacaggacagaaagcaattgtttgaaaaatggctaaaggaggacaagttg
gaatgttctgaagaattgggtgatatcgttaaaccttttgatgtcactctagctcttgcc
tgttatctgagatccaatgcacatagcaaagtcgtctcatgcttggcagaattgcaacaa
tttgaaaagattttaccttactgtcagaaagttgactaccaaccaaacttcttggttctc
atttcctctttattaaggtcttctcccgatagagcctcagaatttgctatatctctttta
caaaaccctgatacagcatcccaattggatatcgaaaaaattgcagatttattcttttca
caaaaccacattcaacaaggtacgtccttattgttagatgccttgaagggggacacacca
gaccaaggtcatctacagactagagtccttgaagttaatcttctgcatgcaccacaagtt
gcagatgcaattttggggaacaacattttttcccattatgataaaccaacaatagcctcc
ctatctgagaaggctggtctatatcaaagagctctagaaaactacactgatattaaagat
atcaagagatgcattgttcacactaatgcattgccagttgactggttggtagcttatttc
ggtaagatgaacgttgaacaatccttggcttgcttgaaagctctgatggataacaatctt
caagccaacatccaaattattgttcaagttgcaaccaagttctccgatctaattggctct
tccattttgattaagttgtttgaagagtacaaggcaactgaaggtctgtactactacctt
gcatctttggtcaacttgaccgatgataaggatgtggtttacaagtacattgaagcagct
gccaagatgaaccaattcaaagaaattgaaagagtggttagagacaataatgtctatgat
cctgaaagagtcaaaaactttttgaaggatgctcgtttggaagaccaaattccactaatc
atcgtatgcgatcgtttcaacttcgttcacgaactggtcttgtacttgtacaagtctcag
aacatgaagttcatcgaggcctatgttcagcaagtcaacccgtcgagagctccacaggtt
gtgggtgctttgctagatgtcgattgcgatgaaaagttcattaaggacttgttacaatcc
gttttgggtcaagtttcaatcaacgaattgacaaatgaagtcgaaaagagaaacagacta
aagattctattacctttcttggaagaaactttggctcaaggtgttcaggatcaaggtgtt
tacaatgccttggccaagatttacatcgactctaacaacgcccctgaaaagttcttgagg
gagaatgatcaatatgacaccattgacgttggtcgttactgtgaaaagagagatccatac
ttggcttatattgcttacgaaaagggctctaacgatgaagatttgatcagaataactaat
gacaatagcatgtacaagtaccaggcaagatacctattgaagcgttctgatccaaacttg
tggaacatggttttggctgaggataacagccacagacaacaactggttgaagctgtcata
tctgtcggcattccagagcttactgacccagaacctgtctccctagcggttcaagccttt
atgtcgaatggtttgaaactagaattgatcgaattgctagagaaaattatcttggagcct
tcggcttttagtgacaatgtcgctttacaaggcctcctacttctatcggcaatcaagtat
gaaccatcaaaagttggttcttacatcgaaaagttggaaaactacgatgctgatgaaatt
gcgccattgtgtattgaaaacggtttgaatgaggaagcctttgaaatttatgagaagcat
aatatgcatagcaaggctttgaaggttttagttgaggacatcatgtctctagacagagct
caaaactttgtggaaaagatcgatacacctgaactatggtctcaattaggtactgcacaa
ttggacggtttgcgtatcccagctgctattgaatcctatatcaaagcagaagatccattt
aactatgaaaatgttatcgaggtcgctgaacaaggtggtcactttgaagagctcattcca
tacctaacgatggcaagaaaaactctaaaggaacctaagattgacggttcgttgatttta
gcttacgctcagttgggtaaaattcacgaaatcgaaaacttgttatcgacatcaaacgtt
gccaatctggaagcggtgggtgacaagttgttagaaaatcaagattacaaagctgctaaa
ctctgctatttgagtgtttcgaattattccaaactcgcatcaactttggtgtatctcgaa
gattaccaggctgccgtcgacactgcaaggaaggcttcaaacataagagtctggaagctg
gtcaatgacgcctgtatcgacaaaaaggaattcagattagcacagatttgtggtctaaac
ttgattgtgcacgctgaggagttggatgaattggttgaaatttacgagtcgaagggttac
tttgaggagttgatttctttatttgaagctggtttaggattagaaagggctcacatgggg
atgtttaccgagctagccattctgtactccaagtatgaaccagagaagacttttgagcac
ttgaaactcttctggtccagaatcaatattcctaaggttattagagccgttgaacaagcc
catttatggaatgagctaatatttttgtatgctcattacgacgaatgggataacgctgcg
ttgacgattattgaaaaggtcaccgatgacttggatcacgcttacttcaaggaggttatt
gtaaaggtctcgaacttggaaatatactataaggctatcaacttttatgtcactgaacat
ccatctttattagttgacttgctggccgttttaacacctagattggacataccaaggact
gtgagaattttctcaaagtcagacaacttgccattgatcaagccatttttaatcaatgtt
ctgccaaagaacaactctgttgttaaccaggcataccacgatttgatgattgaagaggaa
gattacaaggcgttgcaaagcgctgttgattcctatgataaattcgatcaactcgggctt
gctgctagactggaaactcatgaggttatcttcttcaagaagatcgcggctctattgtac
cgtcgtaacaagaaatggtcgaaggctttatcgatcttgaaggaagagaatctttggaag
gacgccattgagactgctgccatctctggtgatgccaaagttgttgaagatctacttgtt
tactttgtcgaaaacgacaaaaaggaggcatttgttgccctgctgtacacagcttacaac
ttgatcaaatatgactttgtcttggagctatcgtggttgcattccttgggtgattatacg
aaaccatatgaaatctcggttaagaaagagcaatcagacacaattgaaaaactactctaa

DBGET integrated database retrieval system