KEGG   Torulaspora delbrueckii: TDEL_0E00170Help
Entry
TDEL_0E00170      CDS       T02236                                 

Gene name
TDEL0E00170
Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tdl  Torulaspora delbrueckii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TDEL_0E00170 (TDEL0E00170)
  Lipid metabolism
   00561 Glycerolipid metabolism
    TDEL_0E00170 (TDEL0E00170)
   00600 Sphingolipid metabolism
    TDEL_0E00170 (TDEL0E00170)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    TDEL_0E00170 (TDEL0E00170)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TDEL_0E00170 (TDEL0E00170)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(18617..19789)
Genome map
AA seq 390 aa AA seqDB search
MLVPDSTKFPNGMKHVADHLHENDFLFGMYSSAGEYTCAGYSGSLGHEEDDAAFFAQNEV
DYLKYDNCYNRGQFGSPEISFNRYRAMSEALNKTGRPIFYSLCNWGQDLTFYWGSGIANS
WRISGDITADFDRPDSRCPCDGDEYDCAYAGFHCSIMNILNKAAPMGQNAGTGGWNDLDC
LEVGVGNLTDDEEKAHFSMWSIVKSPMVIGADVRNLKPSSFSIYSQASVLAINQDPAGIP
AVRVWKRSVPETDQYGQGEIQLWSGPLDNGDRVVALLNGGMKERPMVAYLEDIFVDSFLG
SEELTSTWDVYDLWANRVDNMTASQILDGSRSANGLLYNATQTSYADGLKANDTRLFGGR
VGTIEPYGLLNATVPAHGGGLFRLRRQAQN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgttggtcccagattctaccaagttccccaatggtatgaagcatgttgcagaccatctg
cacgagaatgattttttgtttggtatgtactcctcggcgggagagtacacttgtgccggc
tattctggatctttaggccatgaagaagacgatgcagcctttttcgctcaaaacgaagtg
gattacttgaagtatgacaactgttataatcgtggtcaattcggctctcccgagatttcc
ttcaatcgttaccgtgccatgtcggaggctctgaacaaaactggaaggccaattttctac
tctttgtgtaactggggtcaggatttgacattctattggggttccggcatcgctaactct
tggagaatcagtggtgatatcacagccgattttgatcgtccagatagcagatgtccgtgt
gatggagatgaatacgattgtgcatacgcaggattccactgttcaattatgaacattttg
aacaaggcagcaccaatgggacaaaatgcaggaactggtggttggaatgatttagactgt
ttggaggtcggtgtcggtaatttgacagatgatgaagaaaaagcccacttttctatgtgg
tctatcgtcaagtctccaatggtcattggtgctgatgttagaaacttgaaaccctcttct
ttttcgatctacagtcaggcctcggttttagccattaaccaggatccagccggtattcca
gccgttagagtatggaaacgttctgttcctgagactgatcaatatggtcaaggtgaaatt
cagctatggagtggtccacttgacaacggtgatcgtgtagtagccttattgaatggtggt
atgaaagagagaccaatggttgcttacttggaggatattttcgttgacagcttcttaggt
tctgaagagttgacttccacttgggatgtttatgacctgtgggccaaccgggttgacaat
atgactgcttcccagattctagatggttcccgctctgcaaacggtctgttgtataatgcc
acacaaacttcatatgctgatggtttgaaggcaaacgacacaaggttatttggtgggaga
gttggtaccatcgagccttatggattattgaacgcgaccgtccctgcccacggtggtggc
ctcttcagattgagaagacaggctcaaaattaa

DBGET integrated database retrieval system