KEGG   Torulaspora delbrueckii: TDEL_0E02980Help
Entry
TDEL_0E02980      CDS       T02236                                 

Gene name
TDEL0E02980
Definition
(RefSeq) hypothetical protein
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tdl  Torulaspora delbrueckii
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    TDEL_0E02980 (TDEL0E02980)
   00514 Other types of O-glycan biosynthesis
    TDEL_0E02980 (TDEL0E02980)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     TDEL_0E02980 (TDEL0E02980)
Glycosyltransferases [BR:tdl01003]
 O-Glycan biosynthesis
  O-linked Man type
   TDEL_0E02980 (TDEL0E02980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(564331..566301)
Genome map
AA seq 656 aa AA seqDB search
MGQMDNKKALECESLPLEKGPYRTYQPVNSYWHNDLGRLKLHDVLVSITITVAFIAYMVR
FHASEFTSNPSEAENEILIAIEYYKLGKFRLVALPPFGIQLLSLVPLNKEILRQLSLTFS
SLTLAVLYLTLRRVDTYLPFALGCVTAIASLPLYQEESVSVSVDTLQWLLLALSFYSWRT
VLCSRIFSKKWFNYMILLSITLGLSASTKFAGTFVCIWIATLAMKGFWSVLGDPKLSVSY
LLKYTLFKVLFLGIIPFAIFTSSYALQLGHWSEDSPEFSQYMTPNFKAYLRGPIEQPKFL
YYGSIVTLRHVDSLGGYLHSHNHTYLGGSQEQQVTLTQEENDYNNQWIVEPARPKADAEL
KEVKDFGKIRLRHRATGKLLRASSAKPPVSEQEYTSEISCTGDADYVGDSDELWTAISVG
DPLHSPIMPIKSAVKFLNEGHRCTLLSHDTRLPEWAFYQQEVLCVQSPNEARTLFEFETL
QLNTTEEIEYSASGCNWNSIVGLKSLLIELIQRQYKWNNYVPGFQHEPNSEKWPFHLFKQ
RYVNHIWLSSVLYPICFFIYQTLVALIWDIPSTTVSKAQASCNVIYFDFAIECILGWLNL
YRPMLAYPFADQRIVTYLPSLILGQLLVWKAMDTWTKTRPWVAVPLCVYVAYTVRP
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgggccagatggataacaagaaagctctcgaatgcgagagccttccactcgaaaaggga
ccttacagaacgtaccaaccggtgaattcttactggcacaatgacttgggaagactaaag
ttacacgatgttctagtgtcgatcactataacggtcgcgttcatagcatatatggttcgt
tttcatgcctctgagttcaccagtaatccaagtgaagcagaaaatgagatcttaattgcc
attgagtactataagttgggcaagtttcgcctagtggctttacctccattcgggattcaa
ttgttgtctctagtgcccttgaacaaggaaattttacgtcaattgtctctcactttctca
tccttgactctagcagtgttgtaccttactcttaggagagtggacacttatttgcctttc
gcccttggttgtgttaccgccattgcatctctgccattataccaggaggagtcggtatcc
gtttctgttgatactttgcaatggctacttttagcactttcattctactcatggcgtacc
gttctatgctcacgaatattttctaaaaagtggtttaactacatgattctgctatcgatt
acattagggcttagtgcatctacaaagtttgcaggaacttttgtatgcatttggattgct
acactagcgatgaaaggattttggagtgtgctaggtgatcccaagttatcagtgagctat
ttgttaaagtatacactttttaaagtgttgttccttggtataatcccattcgcaatcttc
acctcatcctacgctttgcagttgggtcattggtcagaggattctcctgagttctcacag
tacatgactccaaatttcaaagcttacttgaggggacccattgaacaaccaaaattctta
tactacggctcaatcgttacgctacgtcatgtggactcgctaggcgggtatttgcactct
cacaaccacacctatctggggggatcgcaggaacaacaggtcactttgacgcaggaagaa
aacgattataacaaccaatggatagttgagccagcaagacccaaggcagacgcggaattg
aaagaagtgaaggatttcggtaaaattagattgaggcatcgtgctacaggtaagcttttg
cgagcatcatctgctaaaccgcctgtctcggagcaggagtacacttcagagatttcatgt
accggtgatgctgactatgtcggcgactccgatgaactttggactgcgatctctgttggt
gatccactccactcaccaattatgccaataaaatctgcagtcaagtttttgaacgaaggt
catcgctgtacattgctttcgcatgacactagactgcctgaatgggctttctaccaacag
gaagttttgtgtgtacaatctcccaacgaagctagaacactattcgaatttgagacttta
caattaaacactacagaggaaattgaatacagcgcttcaggctgtaattggaacagtatt
gtgggtttgaaaagtcttttaatcgaattaatacaaagacaatataaatggaacaactac
gtaccaggatttcagcatgaaccgaactccgaaaaatggccctttcacctgtttaagcag
aggtatgtcaatcatatttggttatcctctgtattgtatccgatttgtttcttcatctac
cagactctagtcgctttgatatgggatattccaagcaccactgtgagtaaagctcaggcg
tcctgcaatgtcatctattttgactttgcaatagagtgtatccttggatggctaaacctt
tatcgtccaatgcttgcctatccatttgcagatcaaagaatagtaacctacctaccgagc
ttgatacttggccagctactggtatggaaagcgatggacacctggactaagactcgccct
tgggttgccgtcccactatgcgtttatgtagcctacacggtacgcccttag

DBGET integrated database retrieval system