KEGG   Torulaspora delbrueckii: TDEL_0E03350Help
Entry
TDEL_0E03350      CDS       T02236                                 

Gene name
TDEL0E03350
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TDEL_0E03350 (TDEL0E03350)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:633291..635345
Genome map
AA seq 684 aa AA seqDB search
MDNTDLGVLCALILAIAIYLKREQIKEFISSNDDDIMASNSDSRDVVQVLRENNKNYLVL
FASQTGTAEDYAKKFAKELASKFSLKVMCGDIEQYDFENINELPDNVFVTLFISTYGEGD
FPDGAVQFEDFISNASEGSLDTLKFSLFGLGNSTYEFYNGAARKALDYLKAAGATLVGDF
GQGDDGAGTTDEDYMTWKGNTFETLKDKLHLDEHEQKFEPSFVLKKLESIDDNVAVGEPS
LHYLPCNKLTYNSEKVQVGPFDLSQPFIAPVVKTYELFKNTDRNCIHTEFDVSGSNIKYS
TGDHLAVWPSNATEKVDQFLKVFNLDPGMIFDLKPLDSTIKVPFPTPTTVGAAVRQYLEI
SGPISRQIFGQLVQFAPNQDIKQKLIDLSTDRDQFAIEITAKYFDLADALLRLSEGKPWS
TVPLEFLVETIPHLQPRYYSISSSSLSEKQTIHITSVVENFPNPSSDVEGNVTGVTTNLL
RNIQLAQNKQETKDSMPVHYNLNGPRDLLAGFKLPVHVRRSTFRLPSNPATPVIMVGPGT
GVAPFRGFVRERVKFLEKQENIKLGKHILFYGSRNQDDFLYQDEWPEYSKKLDGAFEMIV
AHSRLPNAKKVYVQDKLLEREDEVFDMINNGAFIYICGDAKGMAQGVHTSLVDILTRKKA
IAKEDAAEIIKMLKTTGRYQEDVW
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggataatacggatctgggagtgctgtgcgctctaatcctggcgattgccatctatttg
aaacgagaacaaatcaaggagtttatttcatcgaatgatgacgacattatggcttctaat
tccgattctcgagatgtagtacaagttcttcgtgaaaataataagaactacttggtactg
tttgcatcgcaaactggtacagcagaggactatgccaaaaaattcgccaaggaattggct
tccaaattttctttgaaggtgatgtgtggtgatattgaacagtatgattttgaaaatata
aatgaactacctgataatgtgtttgtgactctgttcatctctacttatggcgaaggtgac
tttcctgatggagctgtgcaatttgaagatttcatttccaacgccagtgaaggttctttg
gatactttgaaattctccttgttcggtctaggtaactcaacttatgagttttacaatggt
gctgctagaaaggctttggactatttgaaagccgctggtgccactctagtgggtgatttc
ggacaaggtgatgacggtgctggaaccaccgatgaggattacatgacttggaagggaaac
actttcgagactttaaaggataaactacatttggatgaacatgaacaaaaattcgaacca
tcttttgttctgaaaaaactagagtcaattgacgataatgtcgctgtcggtgaaccatcg
ctgcactacttgccatgtaacaagcttacttataactctgagaaggtacaagtgggtcca
ttcgacttgtctcaaccattcattgctcccgtggtgaaaacctacgaattgttcaaaaac
actgaccgtaactgtattcacactgagtttgacgtctctggttccaatatcaagtactcc
actggtgaccatttggccgtctggccgtcgaatgccactgagaaagttgatcaattcttg
aaagtgttcaacttggacccaggtatgatttttgatctaaaacctctcgattccaccatt
aaagttcctttccctactccaaccactgttggtgctgcagtcagacagtacttggagata
agtggaccaatctccagacagatctttggtcaattggttcaatttgctccaaaccaagat
ataaagcaaaaactgatagatttatccactgatagagatcaatttgccattgaaatcact
gccaagtatttcgacttggccgacgcactattacgtctttctgaaggtaaaccatggtct
accgttcctttagagtttttggtcgaaaccattcctcatttgcaacctcgttattactcc
atctcatcttcttctttatctgaaaagcaaacaattcacataacttccgtggttgaaaac
ttcccaaatccatccagtgatgtcgagggcaatgttaccggtgtaactactaaccttttg
agaaatatccaacttgctcaaaacaagcaagaaaccaaagactctatgccagttcattat
aatctaaacggtcctcgtgatcttcttgctggtttcaagctacctgttcatgttcgtcgc
tcaactttcagattgccatctaatcctgcaaccccagttatcatggtcggtccaggtacc
ggtgtagcaccattccgtggcttcgttagagaacgtgttaaattcttagaaaagcaagag
aacatcaagttaggtaaacacatcctattttatggttctcgtaatcaagatgatttccta
taccaagatgaatggcctgagtactccaagaaacttgatggggcttttgaaatgatcgta
gctcactcgagattgccaaacgccaagaaagtatacgttcaagacaagctactcgaacgt
gaagatgaagtgtttgatatgatcaacaacggtgcattcatctacatttgtggtgatgcc
aagggtatggctcaaggcgttcatacctccttggtggatatattaacacgcaagaaagcg
attgctaaggaggatgccgctgaaataatcaagatgttgaagaccactggtagataccaa
gaggatgtttggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system