KEGG   Torulaspora delbrueckii: TDEL_0E03520Help
Entry
TDEL_0E03520      CDS       T02236                                 

Gene name
TDEL0E03520
Definition
(RefSeq) hypothetical protein
Organism
tdl  Torulaspora delbrueckii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:657779..659251
Genome map
AA seq 490 aa AA seqDB search
MCDKIERHTFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFTEAAEDTTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGTFAGLYLYEELMECDMHQIIK
SEQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGKPIFKGKDYVN
QLNRILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVDIFPQANPEALDLLERMLA
FDPSRRITVNEAIKHPYLSIWHDPADEPVCSEKFEFSFESVNEMEELKQMVIQEVQDFRS
FVRQPLLEEQERQQQEKLQQSPQDHQFLQQQQGAADQQASKESELASQMVSMQPNGGYAQ
LQDSFVGIDARDLPRHDSDSPPRPQENLLASPIALKSNSDGTIPSATQTGYAEFLDLEKE
LEFGLDRKFA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaaattgagagacacacttttaaagtgttcaaccaggactttaccgtggat
aaaaggttccaattgatcaaagagattggccatggtgcatacggtgtggtttgctctgcg
aggttcacggaggcagctgaggatactacagtagcgatcaagaaagtgacaaacgtgttt
tcaaaaactcttctttgtaagagatcgttacgtgaattaaaattactgagacattttaga
ggtcataagaatattacttgtctttatgatatggatattgttttctatcccgatgggact
tttgctggattgtatttgtacgaagaattaatggaatgtgacatgcaccagattataaaa
tcagaacaaccattgacggatgcgcattaccagagttttatctatcagattctttgtgga
ctgaaatacattcattcagctgatgttttgcatcgtgatttgaaaccggggaatctgctt
gtgaatgccgactgccagctaaagatatgtgattttggtttggctagaggctactcggaa
aatccagttgaaaataatcagtttctgacggaatacgtggcgacaagatggtaccgtgct
cccgaaatcatgctgagttatcaaggttatacaaaggctatcgacgtatggtctacgggg
tgtattttagccgagtttttaggtgggaaacctatctttaagggtaaggactacgtgaat
cagctgaatagaattctgcaggttttgggtacccctccagatgagactttgaaaagaata
ggatcgaagaacgttcaggactatattcatcaattgggcttcataccaaaagtacctttt
gtagatattttcccacaggccaatcccgaggctcttgatctattggagcgtatgctagca
ttcgatccttcaagaaggataaccgtgaatgaggcaataaagcacccatatttatcgata
tggcatgatcccgctgatgagcctgtgtgcagtgaaaagttcgagtttagctttgagagt
gtgaacgaaatggaggaactcaaacagatggtgatacaggaagttcaagattttaggagt
tttgtgaggcagccactcttagaagaacaagaacggcagcagcaggaaaaactacaacaa
tcaccacaagatcaccaattcttgcaacaacaacaaggcgcagccgatcaacaagcttcg
aaagagagcgaacttgctagtcaaatggtctccatgcagcccaatggaggttatgcacaa
ttgcaggattcgtttgtgggcattgatgcacgcgatctgccccgtcatgattctgattct
cccccaaggcctcaagagaatttgctagcctcacccattgcattgaaatcgaactcagac
ggtactattccttcggcaacgcaaactggctacgctgaatttttagatttggaaaaggaa
ctggagtttgggcttgatcgaaaattcgcttaa

DBGET integrated database retrieval system