KEGG   Torulaspora delbrueckii: TDEL_0E03520Help
Entry
TDEL_0E03520      CDS       T02236                                 

Gene name
TDEL0E03520
Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
tdl  Torulaspora delbrueckii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TDEL_0E03520 (TDEL0E03520)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TDEL_0E03520 (TDEL0E03520)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TDEL_0E03520 (TDEL0E03520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:657779..659251
Genome map
AA seq 490 aa AA seqDB search
MCDKIERHTFKVFNQDFTVDKRFQLIKEIGHGAYGVVCSARFTEAAEDTTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGTFAGLYLYEELMECDMHQIIK
SEQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGKPIFKGKDYVN
QLNRILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVDIFPQANPEALDLLERMLA
FDPSRRITVNEAIKHPYLSIWHDPADEPVCSEKFEFSFESVNEMEELKQMVIQEVQDFRS
FVRQPLLEEQERQQQEKLQQSPQDHQFLQQQQGAADQQASKESELASQMVSMQPNGGYAQ
LQDSFVGIDARDLPRHDSDSPPRPQENLLASPIALKSNSDGTIPSATQTGYAEFLDLEKE
LEFGLDRKFA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaaattgagagacacacttttaaagtgttcaaccaggactttaccgtggat
aaaaggttccaattgatcaaagagattggccatggtgcatacggtgtggtttgctctgcg
aggttcacggaggcagctgaggatactacagtagcgatcaagaaagtgacaaacgtgttt
tcaaaaactcttctttgtaagagatcgttacgtgaattaaaattactgagacattttaga
ggtcataagaatattacttgtctttatgatatggatattgttttctatcccgatgggact
tttgctggattgtatttgtacgaagaattaatggaatgtgacatgcaccagattataaaa
tcagaacaaccattgacggatgcgcattaccagagttttatctatcagattctttgtgga
ctgaaatacattcattcagctgatgttttgcatcgtgatttgaaaccggggaatctgctt
gtgaatgccgactgccagctaaagatatgtgattttggtttggctagaggctactcggaa
aatccagttgaaaataatcagtttctgacggaatacgtggcgacaagatggtaccgtgct
cccgaaatcatgctgagttatcaaggttatacaaaggctatcgacgtatggtctacgggg
tgtattttagccgagtttttaggtgggaaacctatctttaagggtaaggactacgtgaat
cagctgaatagaattctgcaggttttgggtacccctccagatgagactttgaaaagaata
ggatcgaagaacgttcaggactatattcatcaattgggcttcataccaaaagtacctttt
gtagatattttcccacaggccaatcccgaggctcttgatctattggagcgtatgctagca
ttcgatccttcaagaaggataaccgtgaatgaggcaataaagcacccatatttatcgata
tggcatgatcccgctgatgagcctgtgtgcagtgaaaagttcgagtttagctttgagagt
gtgaacgaaatggaggaactcaaacagatggtgatacaggaagttcaagattttaggagt
tttgtgaggcagccactcttagaagaacaagaacggcagcagcaggaaaaactacaacaa
tcaccacaagatcaccaattcttgcaacaacaacaaggcgcagccgatcaacaagcttcg
aaagagagcgaacttgctagtcaaatggtctccatgcagcccaatggaggttatgcacaa
ttgcaggattcgtttgtgggcattgatgcacgcgatctgccccgtcatgattctgattct
cccccaaggcctcaagagaatttgctagcctcacccattgcattgaaatcgaactcagac
ggtactattccttcggcaacgcaaactggctacgctgaatttttagatttggaaaaggaa
ctggagtttgggcttgatcgaaaattcgcttaa

DBGET integrated database retrieval system