KEGG   Torulaspora delbrueckii: TDEL_0E03650Help
Entry
TDEL_0E03650      CDS       T02236                                 

Gene name
TDEL0E03650
Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tdl  Torulaspora delbrueckii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TDEL_0E03650 (TDEL0E03650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:684366..689384
Genome map
AA seq 1672 aa AA seqDB search
MTMNWSAGEFESLYNGIESGEIDRKLFDEVLLDLQSLNLNDGKFKNSDSRARLEKGEITL
SDGNTYKINQDFMIAAIAVSDELNLDEMVVCEIMLADCNVESLEKDEGIALVNKAKINYF
VRRQYILQIVTFLVNYLDPDSPLYIELLANGKLVSNILRAFGYIHTQLGDIKQSISKAKI
LDSYHALAQQNVKFKQDFLLREYDILSQILHGLMTKGALMSKEHLTKIISHVSEMQSNDF
FIIYYLPAIFYAFGNMNKLLDQDVRSIHDEFLKDLKSQSIYTKPVKVSLIFVFLSYFIGW
CKLEPEKRANTMDFAVTVDEPMTRAVEYGAIEQLLIFAADTSLVERDASIDLYYDMRSLL
ERHIPRLIPIQLTDNQTELQQQQQQQQQFYSHAPLPGSHSNSSQQLNNDRSSAVVLSKQT
NSFFLATFHDVIRTIIADCAFLLTKIKDAEEDSLLSGEDLDLDDIALKADLERFFLTIYY
FYASRPDYSKLFWQDKESNAYGFIEWSAKCHDSLMRSCFYLMISSLSYGTENSLSVYHYF
VANDSVSWNIIAQCISDYIVKISNLTTRVQQRQQKQDSEEIDSTLVALEDGLNEEAIIFI
SSLFTLIGSVANDVDEDIKSTLSNLFADILFEFAKLDTPLIGACLKTLSHLVPNSESKRS
NFWYSLDSLIFKSSQSVITPDSYRAAFTSTFTNFSEVVGFLSLFQKLLSINSMDSDSGYM
SFGKLAFPSKLGRGYRKTGISPYLDYIFQEILVHSNQLQDSFKTRCIQLPVLRIAEDALR
SFDYNVILNSIPAGANLDRLVDTEDFASYVQECPATIAFNYLFTEKVYKCILDIASIGVD
SINIDLVGEQEQLLLINLSVKVVGIVLDFQEPYVEEFVPIVTKQGDIDSFIPKDFGLHGL
RSFYDALFFNLSVVAHLGLYVGLDNFELASNSLHLLEKLAIRYTGEESPFAVKSKLLTIF
DSVDESARIKDGFISQIEKPIDCEEALTLKLELLDFINENLSFTDPTITISHFLLGFQVS
NILSTGPNLSTFINSDSSLLKSIMALLEASLENVNQTRIDCAPMRLAASAICIIIKLCRN
HVTSRMVLDYLATHRLFERIIELDPQVDAHTSWNGRVFDVKKASRAKDFIQTESLGALLS
FLSYRSDLLQYFSLSIHRLASSGRKSQIQSQIELLTSNTLQSAGIFSMLSTLNYGDIPAL
EDSMDSLTIFKTLPLNLDAVTLGNNCHGNIYNYYAIDSLARLSWRFKRESATAPENRSLT
FEQVAQEIDVIHQNIAYILARQTFTKRQLCILHSWVQLVEIIVSDGELTALDRSSFILEV
FGATIPKINDYIEFDISFSEELVSLAVTLFAVYQKDRVSIDNFQTVDTRLYNLFKTCIYG
INSPLSSFSIRSDFYVLANSYLVRVLEDERLAKQILQGLKMNNEVLVEVICKDTIYGQGT
NRITSVFLLDSLVRLGDLNKGNFILDSLTKNTQLLLIIRSIKNTDSLFSSPGSVAIDDLL
YELTAFKTVVYLLIRIAESRNGANALIQNKLFRVIEDCQFLKLDPDLGLELVFDELAIHN
SSFMSINVSLDKPLFLGKDANGISLFELIVPVFQLLAAVLLSMGSSNAMVINEVKKLLIK
YRRLTLGVMKRDALRDTNEKYSSSNSNLEGLEKMVKLVVLLCTLTGYHGEES
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaattggtcggctggtgagttcgagtccctttacaatggcattgaaagtgga
gaaatagatcgtaaattgtttgatgaagtgctattagatttgcaaagtttgaatttaaat
gatggcaaattcaagaacagtgatagccgagctcgattagaaaagggtgaaattacttta
tcagatggaaacacgtataagattaatcaggattttatgatcgcagcgattgcagtatct
gacgaacttaatctagacgaaatggttgtatgcgagattatgcttgccgactgtaacgtt
gagagtttggaaaaggatgaaggtattgcgttggttaacaaagccaagataaactatttt
gttagaagacaatatattttgcaaattgtgacatttctggtgaactaccttgatcctgat
agcccgctttatatcgagctgttggcaaatgggaagttagtatccaacatactgagagca
ttcggctatattcatacacagctaggtgatatcaagcagtccattagcaaggcaaagatt
ctcgacagttaccatgcattggcacaacagaatgtcaaattcaaacaagattttctgctg
agggagtatgacatattgagtcagattcttcatggtttgatgaccaaaggagccttgatg
agtaaagaacatttaacaaagataataagccatgtttccgagatgcaatcaaatgatttc
ttcataatatattacctgccagcgatcttttacgcttttggtaacatgaacaaacttcta
gaccaagatgtaaggtctattcatgatgaatttttaaaggatctaaaatctcaaagcatt
tacacaaaaccagtaaaggtctcattgatctttgtcttcctctcgtacttcattggctgg
tgtaaattagaacctgaaaagagggccaatactatggattttgccgtgacggtggacgaa
ccaatgactagagctgtagaatatggggcgatcgagcaattattaatttttgccgctgat
acttctctagtagagagagacgctagtatcgatctttactatgatatgagatcattgcta
gagcgtcacatccctaggctgatacccatccagttgacagacaatcaaacggaacttcaa
cagcagcaacagcaacaacaacaattttacagtcatgctcctctacctgggtctcatagt
aatagttcacagcagctgaataatgacagatcttcagctgtagtactctcgaagcaaacc
aactcttttttcctggcaacttttcacgatgttataagaaccattattgcggactgcgca
ttcttgcttacgaagattaaggacgcagaagaagattcactgttatcgggagaagatctt
gatctagatgacatcgccttgaaggcggatttggaaagattcttcctcacgatttactat
ttctacgcgtcgagacctgattactccaaactattttggcaggataaggaatcaaatgct
tatggtttcatcgaatggtcggctaaatgtcatgatagtttaatgagatcatgcttttac
ctaatgatttccagtttatcttacggaaccgaaaactctctaagcgtttatcactacttt
gtggctaatgacagtgtctcatggaatatcattgctcaatgcattagcgactatatcgta
aagatcagtaatctgacaacacgagttcagcaaaggcaacaaaaacaggactcagaggaa
atagactctacgttagttgcgttagaagatggcctgaatgaagaagctatcattttcatt
tcttcattgttcactttgattggatcagttgcaaatgacgttgacgaggatattaaaagc
actctgtcgaacctcttcgcagacattctctttgaattcgcaaaattggacacacctcta
attggagcatgcttgaaaacgttaagccatctagtacccaactcagaatcaaagagatca
aacttctggtattctttagactcgttaatcttcaagtctagtcagtctgtaatcacccct
gattcttacagagcagccttcacttcgacttttaccaacttttccgaggttgtcggcttt
ttgagccttttccaaaaactattatccatcaattccatggatagcgacagtggttacatg
tcctttggtaaacttgcattcccaagtaaacttgggcgtggatataggaaaacaggcatc
agtccttatctcgactacattttccaagaaattttagtgcactccaatcaattacaagat
tctttcaagacaagatgcattcaattgcccgtcctgagaattgcagaggacgccctccgt
tcgtttgactataatgttattttgaattcgattccagcaggtgctaatcttgaccggtta
gtagacacggaagattttgcgtcttatgttcaggaatgcccagcaacaattgccttcaac
tacctttttacagaaaaagtctacaaatgcattttggatatcgcttctattggggttgac
agtatcaatattgacttggtcggcgaacaagagcaattgcttctcatcaatctatctgtt
aaggtggtgggtattgtcttggatttccaagagccttatgttgaagaatttgtgccaatc
gtgacaaaacaaggtgacatagacagctttataccaaaagattttggtttacacggattg
cgttctttttatgacgctttgttcttcaatttatcagttgttgcccatctcggcttatat
gtcggcttagacaattttgaactagcatcgaactccttacatttgcttgaaaagcttgca
attcgttatacaggtgaggaatccccatttgccgtaaagagtaagctcttaacaatattc
gattctgtggatgagtctgcacgcatcaaggatggattcatatcgcaaatcgagaaaccg
attgattgtgaggaagctctcactttgaaactcgagctcctagatttcatcaatgagaac
ttgtcattcacggatcctactattactatctctcacttcctgctaggttttcaagtctct
aatattctctccaccggacctaatctatcaaccttcatcaactctgattcttccttattg
aaatccatcatggctttgcttgaagcatctctcgaaaacgttaatcaaaccaggatagat
tgcgctccaatgaggctagccgcctcagctatatgcataataataaaactttgtcgtaat
catgtcacttcccgtatggtcttggattacttggcgacacatcggctgttcgaaagaatt
atagagctcgatcctcaggttgacgcgcacacatcgtggaatggaagggttttcgacgtt
aagaaggcatctagagctaaggatttcatccaaacagagtccctaggtgcgttgttatca
ttcttgagctatagaagcgatttactccagtattttagtttgtccattcacaggctggct
tcgagtggaagaaaatcacagatacaatcccagattgaactattgacctcgaacaccctc
caatctgcaggaattttttccatgctaagcactctaaactatggagatatacccgcactc
gaggattctatggattctttgacaatatttaaaacacttccgctcaatttggatgctgtg
accctggggaataattgccatgggaacatctataactattatgcgattgattcactggca
agattatcgtggaggttcaaaagggagtccgcaactgctcccgagaatcgcagcttaacc
tttgaacaggtcgcacaggagattgacgttatacaccagaacatcgcttatattttggct
cgtcagacgttcacgaaacggcaactgtgcatcctgcactcatgggttcaactagtagaa
atcattgtatcagatggtgagctaactgctcttgatcgttcaagctttattttggaggtg
tttggagccacaatacccaaaatcaatgattatattgagtttgatatatcattctcagag
gagctggtttcgctcgctgtcacattatttgcagtctatcagaaagatcgtgtttcaatt
gataatttccaaaccgtcgacaccaggctttacaatctgtttaaaacatgcatttacggt
attaactccccactatcatcattttctattcgatcagatttttatgtgcttgccaatagc
tatttggtaagagtacttgaagacgagaggctggcgaagcagatactacagggtctaaag
atgaacaacgaggtgcttgtcgaggttatctgcaaggacactatttatggccaagggacg
aacaggataacgagtgtttttttgctggattccttagttcgtctaggagacctcaacaaa
ggtaatttcatattagactccctcacgaagaatacacagctacttttgatcatacgttcc
ataaagaacactgactcattgttcagctctcccggaagcgtcgccatcgatgatcttcta
tacgagctaactgcgttcaaaactgtggtctatttgttgatccgcattgctgagagccga
aatggtgctaatgcattaattcagaataagttattccgagtaattgaggattgccaattt
ttgaagcttgatccagatctcggattagaactagtattcgatgagctagcaatccacaac
tccagctttatgtcgatcaacgtcagtttggataaaccgctattccttggaaaggatgcc
aatgggatatcccttttcgaattaattgtgcccgtttttcaattgcttgctgctgtcctg
ctgagtatgggaagctcgaacgcgatggttattaatgaggtcaagaaacttctcattaaa
tacagacggctgacgttgggagttatgaagagggatgcgctaagagacacaaacgaaaag
tacagttcctcgaactccaatctcgaaggtctggaaaagatggtaaaattggtcgtacta
ctttgcacactaacgggttatcacggtgaagaaagctaa

DBGET integrated database retrieval system