KEGG   Torulaspora delbrueckii: TDEL_0E03710Help
Entry
TDEL_0E03710      CDS       T02236                                 

Gene name
TDEL0E03710
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TDEL_0E03710 (TDEL0E03710)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TDEL_0E03710 (TDEL0E03710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:701912..702886
Genome map
AA seq 324 aa AA seqDB search
MDTRLIRSIPVFRSGYSSLTRNYKPLMFSAITRSNASKFLPFAIGGAAIACSAYYSTRIA
APLKNESSKVFVGDDKWIDLPLSHVEQLSHDTKRYTFDLPGEDSELGLTLCSALMAKFVT
PKGSNVVRPYTPVSDLARKGSFQLVIKHYPDGKMSSHFWNLKPSDTVLFKGPNPKWQWEE
NSFDSITLLGAGTGINPLYQLVHHLSENPNEKTKINLFYGNKTPQDILLKTELDDLQKKH
PDKLKITYFVDKADDGFQGEKGFITKEFLEQHAPKPSEKTHVFVCGPPPFMKAYSGEKVS
PKDQGDLVGILKDLGFSKDQVFKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatacgagacttataagatccattccagtatttagaagtggttacagcagtctaaca
agaaattataagcctctgatgttcagtgctattactagatctaacgctagcaaatttcta
ccgtttgcaattggtggtgcagctatcgcatgctctgcttactattccactagaattgca
gctccattgaaaaacgaatcttccaaggtttttgttggtgatgacaaatggatagatttg
ccattgtctcacgttgaacagttatcccacgatactaagagatatacatttgacttgccc
ggtgaggactctgagctggggctaactctgtgctctgccttgatggccaagtttgtgact
ccaaagggtagcaatgttgtcagaccatacacccccgtgagtgatttggccagaaagggc
tctttccaattggtcattaaacattatccagacggtaagatgtcttctcatttctggaac
ttgaaaccttccgataccgtgttgttcaagggtccaaaccctaaatggcaatgggaagaa
aactcctttgattctattaccttattgggtgctggtactggtatcaacccattgtaccaa
ttggttcaccacttgtccgaaaaccctaacgaaaagactaagatcaacttgttctacggt
aacaagactccacaggatatcttgttgaagacggaattggatgatttgcaaaagaagcac
cctgacaagttgaagattacctacttcgttgataaggctgatgatggtttccaaggtgag
aagggatttatcactaaggagttcttggagcaacacgctccaaagccatctgaaaaaacc
cacgtctttgtttgtggtccaccaccattcatgaaggcttactctggtgaaaaagtctct
ccaaaggaccaaggtgatttggtcggtatcttgaaggatcttggtttctccaaggaccaa
gtcttcaaattctag

DBGET integrated database retrieval system