KEGG   Torulaspora delbrueckii: TDEL_0E05220Help
Entry
TDEL_0E05220      CDS       T02236                                 

Gene name
TDEL0E05220
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    TDEL_0E05220 (TDEL0E05220)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TDEL_0E05220 (TDEL0E05220)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TDEL_0E05220 (TDEL0E05220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(957515..958597)
Genome map
AA seq 360 aa AA seqDB search
MDIGYQQPQHHQPQHHQVPQQYYANYESREKSLLPQKSVVSKGKYSLQDFQIMRTLGTGS
FGRVHLVRSVHNGRYYAMKVLKKQQVIKMKQIEHTNDERRMLKLVEHPFVIRMWGTFQDA
RNLFMVVDYIEGGELFSLLRKSHRFPNPVAKFYAAEVTLALEYMHSHNIIYRDLKPENIL
LDRNGHIKITDFGFAKEVVTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLA
GYTPFYDNTPMKTYEKILQGKVNYPPFFHPDAVNLLSNLITADLTRRLGNLQSGSDDIKS
HPWFSEVVWEKLLAKDIETPYEPPIQAGTGDTSLFDQYPEEHLDYGIKGEDPYAQYFVDF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggatattggataccagcagccacagcaccaccagccacagcaccaccaagtgcctcag
cagtactatgctaactatgaatctcgagagaagtctttgttgccccagaaatctgttgtg
tcgaaggggaaatactcgttacaggatttccagattatgaggaccctggggactggctcg
tttgggcgtgtacacctggtaaggtctgtgcacaacggtcgttattatgcaatgaaagta
ctgaagaagcagcaagtgattaagatgaagcagattgagcatacgaatgatgagcgtagg
atgttgaaactcgtggaacacccatttgttatccgtatgtgggggactttccaggatgcc
cgtaatttgttcatggtggtcgactatattgaaggtggtgaattgttctcactattgcgt
aagtctcatcgtttcccaaatcccgtggccaagttctacgcggcggaagtaactctggca
ttggaatacatgcattcccataacattatctatcgtgatttgaaaccagagaatatcttg
ctggatcgtaatggacatatcaagatcactgattttggatttgccaaagaagttgtcact
gtgacttggactttatgcgggactccggattatatcgcaccggaagtgatcactacaaaa
ccttataacaaatctgtcgattggtggtctctcggagtgctaatctttgaaatgctcgca
ggttacacacctttttacgataacacaccgatgaagacttacgagaagattttgcaaggt
aaagttaactatcctcctttcttccacccagatgcagtgaacttattgagcaaccttatc
acagcagacttgactagaagactaggtaatttacaaagcggatcagacgatattaagtcg
catccatggttcagtgaagtggtgtgggaaaagttactcgccaaggatatcgagacgcca
tacgagccaccgatccaggccggtacaggtgacacttcgctctttgaccagtacccagag
gagcacttggactatggtatcaaaggcgaggacccttatgcacagtattttgtggatttt
tga

DBGET integrated database retrieval system