KEGG   Torulaspora delbrueckii: TDEL_0E05760Help
Entry
TDEL_0E05760      CDS       T02236                                 

Gene name
TDEL0E05760
Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
tdl  Torulaspora delbrueckii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TDEL_0E05760 (TDEL0E05760)
   00500 Starch and sucrose metabolism
    TDEL_0E05760 (TDEL0E05760)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     TDEL_0E05760 (TDEL0E05760)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
5:1077148..1078716
Genome map
AA seq 522 aa AA seqDB search
MYYDASAESVSRPLVHYTPKAGWMNDPNGLFYDRSESTWHIYYQYNPNDTVWGSPLYWGH
ASSKDLTTWTEHADALSPSSNDSSVFSGCVVVDRNNTSGFFNDSINPEQRVVALYTEHSP
VSQRQFAAYSLNGGYTFEKYEHNPVLDGNSTQFRDPKVIWHEETEKWVMTATRSHEYVVQ
IFSSSDLKSWELESNFTRHGFLGYQYECPGLAKVPIVGNSSLVSSGVTHKWVMFLSINPG
SPMGGSFTQYFVGDFDGKVFTPDTAETRLLDYGKDYYALQTFSATENDDVLGLAWASNWD
YAAYVPTYPWRGSMSLVRNFSLREYQPNSEAAQLNLFSEPIINYDALRLNQSIQTNATNI
KKNDQLFFNLSSSAHGLLDLSFEWTVNKSNVGKKDFSALTVKLIGATDKEEYLELGYEAN
AQAFFFNRGNSNVNSMKENSFYSDKMSANVEPYELLSENEAVFKVHAILDRNIAEIYLND
GVSVTTNTFFLTDGNFIGALEVRSSVDDVYTVSNFNVKTTSG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgatgcatccgcagagtctgtctctcgtcctctggtccattatacgcctaag
gctggttggatgaacgaccctaatgggttgttttacgatcgctcggagtccacttggcac
atttactaccagtataatccgaatgataccgtgtggggttcaccgttgtattggggccac
gcatcttcgaaggatttgaccacttggaccgagcatgctgatgcgctctccccttcgagt
aatgactctagcgtcttttcgggttgtgttgttgttgatcgtaacaacacttctgggttc
ttcaacgactctatcaaccctgagcagagagtcgtggcactttacactgaacattcgcct
gtctctcaaagacagtttgctgcttactcgttgaatggcgggtacacttttgagaagtac
gagcacaatccggttctagacggtaactccacccagttcagagatcctaaggttatctgg
cacgaggagactgaaaagtgggtcatgaccgctacacgttcgcatgagtacgttgtgcag
attttcagctcgtctgatctaaagagctgggagctggagtcgaacttcactcgtcatggc
ttcttaggttatcagtatgaatgcccgggcttggctaaggtacccattgttggaaattct
tctttggtcagcagtggtgttactcacaagtgggtgatgtttttaagtatcaaccctggc
tcacccatgggtggctctttcacgcaatatttcgttggtgattttgatggtaaagtattc
actccagacactgctgagaccagattgctggattacggtaaggattattatgctttacaa
actttttctgcgactgagaacgacgatgtgttgggattggcatgggcttctaactgggat
tacgctgcgtatgttccaacatatccttggagggggtcgatgtccttggtgcgtaatttc
agtcttagagaataccagccaaacagtgaggccgcccagctaaatctgttcagcgagcct
attattaactacgacgccttgcgattgaaccagtccatccaaacaaatgccacaaacatc
aagaaaaacgaccaactcttcttcaacttaagctcgagtgctcatgggctgttggacttg
tcttttgaatggacggtcaacaagagtaatgtcggtaagaaagatttttctgctctaact
gtcaagctgatcggagcaactgacaaagaagaatacttggaacttggttacgaggccaac
gcccaggccttcttctttaacagaggcaatagtaatgtcaattctatgaaggaaaattca
ttttactccgataaaatgtctgccaacgtcgaaccttatgaactcttatcagagaatgaa
gcagtgttcaaggtccatgctattttggacagaaatattgctgagatctacctaaacgat
ggtgtttctgtaacgactaatacttttttcctcacagacggtaactttattggggctttg
gaagtgcgtagctcagtcgatgacgtctatactgtctcaaacttcaatgtcaaaacaact
agcggttaa

DBGET integrated database retrieval system