KEGG   Torulaspora delbrueckii: TDEL_0F00460Help
Entry
TDEL_0F00460      CDS       T02236                                 

Gene name
TDEL0F00460
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tdl  Torulaspora delbrueckii
Brite
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   TDEL_0F00460 (TDEL0F00460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(72584..79969)
Genome map
AA seq 2461 aa AA seqDB search
MLSLRRKLESHHQSRKKLTSNSHSEDELSAASGQDGPNGLAGDGSRLNSGADGDSKGYVE
TDPSTAAMDSTFSTFNLIFDKLGSPNAQERITASFELKTSLISLVREVSIEQFQRFSNRI
NNKIFELIHGSSPNEKIGGILAVDTMIGFYAHTEELPNQTSRLANYLRVLIPSNDTEVMR
LAANTLGKLAVPGGTLTSDFVEFEMKTCIEWLTTSPENASSSSKQEYRKHASLLIITALA
NNSPYLLYPYVNSILDNIWRALRDTNLVIRMDAALTLGKCMSIIQDRDTALTKQWVERLF
KECVYGLTLNTNESIHATLLVYRELLKLSAFYLSGKYDEVFQSTARYKDHKYDVIRKEVY
AILPLLASFDSNLFTTKYLDQTMVHYLTVLRNMNASSANASDKPAILVSIGDIAFEVGSN
IVPYMDPILDNIKDGLQTKLKNRKLFEREIFYCIGKLASAVGPALAKHLNKGLLDLMLSC
PLSDYMQQTLLIINEKIPALEPTINARLLDLLCTTLSGEKFKQPGSPTSLKPLSIEKARQ
WRNQRILRRTGEVNDDIHDAQLLTQALRMLQTIKHKYSLTEFVRLVIISYIEHENPHVRK
LAALTSCALFVNDNICKQTSLHALNSVSEVLSKLLAVAITDPVAEIRFEILQHLDSSFDP
QLAQPDNMRLLFMALNDEIFAIQLESIKIIGRLTSVNPAYVVPSLRKTLLELLTKLKYST
MPRKKEESATLLCTLISSSKEVTKPYIEPILDVLLPKSQDNSSAVASTALRAVGELSVIG
GESMKAYLDELMPLIINTFQDQSNSFKRDAALKTLGQLAASSGYVIDPLLDYPELLGVLI
NILKSESAQNIRRETVRLIGILGALDPYKHREVEVTSNAKISVEQNAPSIDIALLMQGMS
PSNEEYYPTVVINTLMKILRDPSLSSHHTAVIQAIVHIFQTLGLRCVPFLNQIVPGIISV
MHSCPPSLLEFYFQQLGLLVSIVKQHIRPHVDEMYVVIEEFFFIPKLQITILSVIESISR
SLEGEFKRVVPRTLTFFLTILENDKSIKKAVSIRILRSLVVFDSNLEDYAHLIIPTVVKI
AEYSTGTLKKMAIVTLGKLAKCINLSEMSSRIVQALVRVLNLEDRELTKVTMNTLSLLLL
QLGTDFTVFIPIINKTLVRNHIQHSIYDQLVNKLLNSEGLPKNIVFDKEFDTNTREVGEA
ESTSKKLSVNQLALKNTWDCSQQRTKEDWQEWIRRLSIQLLKESPSHALRACSGLAGIYF
PLARELFNASFSSSWTELYTQYQEDLVQSLCVALSSPQNPPEIHQTLLNLVEFMEHDDKP
LPIPIQTLGQYAQRCHAYAKALHYKEVEFIQEPTTSTIESLISINNQLHQTDAAIGILKH
AQQHHDLQLKETWYEKLQRWEDALNAYNQRASAGEDSFEVTMGKMRSLHALGEWEQLSEL
ALDKWSVSKPDFRIAMAPLAAGAAWGLGQWDKIEQYIDAMKSQSPDKEFFDAVLCLHRNS
FDEAEKHIFNARDLLVTEISALINESYNRAYSVVVRTQIVAELEEIIKYKRLPQGSESRM
LIRSTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDMQIWIKFANLCRKSGRMGLAQKAL
NSLLEEGGDPDHPNTARAPPPVVYAQLKYLWATGSQKDALRHLIGFTSRMAHDLGLDPSN
MIAQSVPQNSSIAPHHVEDYTKLLARCFLKQGEWRVSLQQNWRAENPDAILGSYLLATHF
DDKWYKAWHNWALANFEVISMITSGSKEEMNGGTEKTNGVYSIENGLMGSDSFSAGPISY
PAELIQRHVVPAIKGFFFSISLSEASSLQDTLRLLTLWFTFGGTPEAAQAMHEGFSLIKI
DNWLEVLPQLIARIHQPDKVVSRSLLSLLSDFGKAHPQALVYPLTVAIKSESVSRQKAAL
SIIEKMRMHSPTLVDQAELVSHELIRVAVLWHEQWYEGLEDASRQFFGEHNTEKMFATLE
PLHEMLRRGPETLREISFQNSFGRDLNDAYEWVTNYKKRKDVSNLNQAWDIYYNVFRRIS
RQLPQLQTLELQHVSPKLLAARNLELAVPGTYAAGKPIIRIAHFEPVFTVISSKQRPRKL
SIRGSDGKDYQCMLKGHEDIRQDSLVMQLFGLVNTLLQNDSECFQRHLDIQQYPAIPLSP
KSGLLGWVPNSDTFHVLIREHREAKKIPLNIEHWVMLQMAPDYDNLTLLQKVEVFTYALD
NTRGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRITGK
VIHIDFGDCFEAAILREKFPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKE
SLMAILEAFAFDPLIHWGFDLPTQTIAEQTDIQLPLTNPSELLRKGAITVEEAAKMEVEH
KNEIRNARAMLVLKRITNKLTGNDFRRFKELDVPEQVDKLIQQATSIENLCQHYIGWCPF
W
NT seq 7386 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctctgaggaggaagctagagagccaccatcagtctcgtaaaaagctgacctct
aactcacactcggaagatgaattgtctgctgcgtctggacaagatggtccaaatggtctt
gcaggggatggatctcgtctgaatagtggtgcagacggtgattcgaaaggctatgtggaa
acggatcccagcactgcggccatggatagcacattttctacttttaatctaatctttgac
aaactaggaagccccaatgcacaggaaaggattaccgcttctttcgaattaaagacttct
ctgatatcattagtgcgtgaagtctctattgagcagtttcagcggttcagtaataggatt
aataacaagatatttgagctgattcatgggtctagccctaatgaaaagataggtggtatc
ttggcagtcgatacaatgatagggttctatgcacatacagaagaattaccgaatcaaact
tcgaggctggctaattacttgcgggtgctgataccttccaatgataccgaagtgatgaga
ttggcggccaacaccttgggtaaactagctgtccccggggggacactcacatcagatttc
gtcgagtttgagatgaagacttgtatcgagtggttgactacatcacctgagaacgcttcc
tctagttcgaaacaggaatataggaagcatgcatcgttgttgataataactgctttggct
aataattcgccatatttgctttatccatacgtcaattcaattctcgataatatttggaga
gctctcagagatacaaatttagtgatacgaatggatgcggccttgacgctgggcaaatgt
atgtccatcatacaggatagagatacagcgctgacaaaacaatgggtagaaagactcttt
aaagaatgtgtttatggtcttacgttaaacacaaacgaatcgatacatgccactttactg
gtctatcgcgaactacttaagctgagtgctttctatctgagtgggaagtacgatgaggtt
ttccaatccacggcaaggtataaagatcacaagtacgatgtcattagaaaggaggtatac
gctatcttaccactcttagcgtcatttgactcaaatttgttcaccacaaagtatctggac
caaacgatggtgcactatctcacagtcctaagaaacatgaacgcaagctcagccaatgcc
tccgacaaaccagcgatactagtatccattggagacatagcgtttgaggtcggctctaac
atagtaccttacatggatcctatcttggataacattaaagacggacttcaaacaaaactg
aagaatcgtaagctgttcgaaagagagattttttactgcataggaaaattggcttcagct
gtagggccagctctggcaaaacacttgaataaaggacttttggacctcatgttatcatgc
ccattgtcagattacatgcaacagacattactcataatcaatgaaaaaataccagcgcta
gaacccactatcaacgctagacttctagacctactgtgtactacgttgtccggtgaaaag
ttcaagcaaccagggtcgccgacttcattaaagccactgtcaatagaaaaagctcgccaa
tggagaaatcaaagaatactccgtaggacaggggaggtcaatgacgatatccatgatgct
caattactcacacaagcattaagaatgttgcaaactataaaacataaatactcattgacg
gaatttgtgagattggtcataatatcctacattgagcacgagaatccacatgtcaggaag
ttggcagcgttaacatcgtgtgctttgtttgttaatgacaacatctgcaagcagacctca
ttgcatgcccttaattctgtatctgaagttttgagtaagttgcttgctgtagccattaca
gatcccgttgctgaaataagattcgaaatattacaacatctagattccagtttcgatcct
cagctagcccagccagataatatgcgccttcttttcatggcgttaaatgacgaaatcttc
gcaatacagttagagtccataaagatcataggccgtttgaccagtgtaaatcctgcgtat
gttgttccttcattgagaaaaacgctattggagttgttaacgaaactcaagtattcaacg
atgcctaggaaaaaggaggagagcgctacgttactttgcacattaataagctccagtaaa
gaagttacgaagccttacattgaaccaatcttggatgttcttcttcccaaatcacaagat
aactcctctgctgttgcttcgacagccctgagagcagttggtgaactttcagtaattggt
ggtgagagcatgaaggcctacttggatgagctaatgccactgataataaataccttccaa
gatcagtcgaactcattcaaaagggacgctgctctaaaaactctaggacagttggcggca
tcatctggttatgtcattgaccctctcttggactatccagaattgctcggcgtcttgatc
aacatattgaaatccgaaagtgcccagaatattaggagagaaacggttcgtctcataggt
attttaggtgcattggatccttataagcacagagaagttgaagttacgtctaacgcaaag
atttcggtggaacagaatgcaccttcaatagatattgccctgttaatgcagggcatgtcc
ccttcgaatgaagaatactatccgacggtcgtaatcaacaccttgatgaaaattctacga
gacccttccctgtcgtctcaccataccgctgttattcaggctatagttcatatttttcaa
actctgggtttacgctgtgttccatttttgaaccaaattgttcctggtattatctccgtt
atgcattcatgtcctccctcacttctggagttttactttcaacagttaggcttgctcgta
tcaatagtgaaacagcacatacgcccacacgtagatgagatgtatgtggttatcgaggag
ttctttttcatccccaaattacaaatcaccattctgtccgtcatcgagtctatatcaagg
tcattggagggagagtttaaacgggttgtaccgagaacattgacgttctttttgactatt
ctcgaaaatgataagtcaataaaaaaagcagtctccatcagaattctcaggtccttagtg
gtatttgactctaatttggaagactatgctcatttaataatcccaacagtggttaaaatt
gctgaatactcgacaggcactctgaaaaaaatggcaattgtaacattaggtaaattggca
aaatgcattaatctatcagaaatgtcttcaagaattgtccaagcgctggtacgcgtactt
aacttggaagacagagaattgacaaaagtaactatgaatactctgagcttactccttctc
cagctggggactgacttcactgtatttatcccgatcatcaataaaactctggtcagaaac
cacatccaacattctatttatgaccaactcgtgaacaaacttttgaatagtgaggggctg
ccaaagaacatagtctttgataaggagtttgacactaatacaagggaagtcggggaagct
gagtcaacttcaaagaaactatcggtcaatcagctagcacttaaaaatacttgggattgt
agtcaacagagaacaaaagaagactggcaagagtggattagaagactatcaattcagctt
ctcaaagaatcgccatcacatgcactaagagcctgctccggtttagcgggcatttatttt
ccgctggctagagaactattcaatgcttctttctcaagttcctggacggaactctacacc
cagtatcaagaagacctagttcaatctctttgcgtagctctttcgtctcctcaaaaccct
ccagagattcatcaaaccctgttgaacttagttgaatttatggaacatgatgataaacca
ctgcctatacctattcagacattgggacagtatgctcaaagatgtcacgcttacgcgaaa
gctctgcattacaaagaagttgaattcatacaagaaccaaccacatcaacaattgaatct
ttgattagtatcaacaatcagctacatcagacagatgctgctatcggaatattgaagcat
gctcaacaacatcacgacttgcagttgaaagaaacatggtatgagaagttgcaacgatgg
gaagatgccctaaatgcgtacaaccaaagagcaagtgctggagaggactcttttgaagtc
acgatgggtaagatgagatctcttcacgctctgggtgaatgggaacagctgtcagagctg
gctttagacaaatggagcgtctcgaagccagattttcgcattgcaatggcacctctagca
gctggtgcagcatgggggttgggccaatgggataagatcgaacaatacattgatgcaatg
aagtctcaatcgccagacaaagagttttttgacgctgtgctatgtttgcatcgcaatagc
tttgatgaagctgaaaagcacattttcaatgcccgtgacttattggtcactgaaatctcg
gctttgattaacgagagttataatagagcctacagcgttgtcgtgaggacgcaaatcgtg
gccgaactagaagagatcataaagtacaagagactaccccaaggttcagagagtcgtatg
ctcatcagaagtacatggaacaagaggcttttgggatgtcagaaaaatgttgatgtatgg
cagagagttttaagggtcagatcgcttgttgtcaaaccaaaacaagatatgcaaatttgg
atcaagtttgcaaacctctgccgaaaatcgggaagaatgggtttggcgcagaaagcacta
aattcattgctggaagaaggtggcgatcccgatcaccctaacacggctcgcgccccccct
ccagtcgtctatgcacagctaaaatacctgtgggccactggatcccagaaagacgcccta
cgtcatttgattggatttacttcgaggatggctcatgatttgggtctagacccaagtaac
atgatagctcagagcgtaccacaaaacagttctatcgcccctcatcacgttgaagactat
acgaaactgcttgcaagatgctttttgaagcagggagaatggagagtctcacttcaacaa
aactggagagctgagaatcccgacgctatcctgggctcttatttgctagccactcatttc
gatgacaaatggtacaaagcatggcataactgggctttggcgaactttgaagtgatctct
atgatcacatcaggttcgaaagaggagatgaatggcggcaccgaaaaaaccaatggtgtc
tacagtatagagaatggattgatgggttcagattcattcagcgccgggccaattagctat
ccggccgaactgatccagagacatgttgtaccagctataaaagggtttttcttctccata
tccctctctgaggccagctctcttcaagatactttgagactattgacactgtggttcacc
ttcggtggtacacctgaggctgctcaggccatgcacgaaggattcagcctaatcaagatt
gataattggctcgaagtgttaccccaattgattgctcgtattcaccagccagacaaggta
gtcagcaggtcattgttgtcccttctctctgattttggtaaagctcatcctcaggctttg
gtgtatccgctaacggttgccatcaaatcagagtctgtttcaagacagaaagcggcttta
tccatcatcgaaaagatgagaatgcatagccccacattggttgaccaagcggaactagta
agccatgagctgattcgtgttgctgtattatggcatgagcaatggtacgaaggccttgaa
gatgccagtagacaattctttggggagcataacacggagaaaatgtttgctacgttggag
ccactacatgaaatgctaagacgtggccccgaaactttgagagagatttcattccagaac
tcttttggaagagatctgaatgacgcttacgagtgggtcacaaactacaagaaaagaaag
gacgtgagcaatctgaatcaggcctgggatatatattacaacgtcttcagaagaatcagc
aggcaactgccgcagttgcagacgcttgaattgcagcatgtgtcacctaagcttctcgct
gctcgcaatctggaattggctgttcctgggacatacgctgctggtaaacctatcataagg
attgcccactttgaacccgttttcaccgttatttcgtccaagcagagacctagaaagctc
tccatcaggggtagtgatggtaaagactatcagtgtatgctaaagggacatgaagacatc
agacaagacagtttggttatgcagctctttggattggtgaacactttgttgcaaaatgat
tcagaatgtttccaaagacatctggacattcagcagtatcctgcaatcccgctatcacca
aaatctggtttacttggatgggttcctaacagtgacaccttccatgtactcatcagagag
catcgtgaggcaaagaaaatcccattgaacatcgagcactgggtcatgctgcaaatggcg
cctgactacgataatttgacattattacagaaagtggaagttttcacttacgcgctggat
aacacgcgagggcaagatctttacaaagtcctgtggttgaagagtagatcatctgagtcc
tggttggaacgtagaactacttatacgcggtctctcgcggttatgtctatggttggttat
atccttggtcttggtgaccgtcatccaagtaatttaatgctcgatagaataacaggaaag
gtcatccacattgattttggtgattgtttcgaggctgccattttgagagagaagttcccc
gagaaagttcccttcagactaactagaatgctcacttatgccatggaagttagtggaatc
gaaggaagtttccgtataacttgtgaaaatgtaatgagagtgctgagagacaacaaagag
tctctgatggccattctggaagccttcgctttcgatcctttaattcattggggatttgac
ttgccaacgcaaactattgctgaacaaacagacattcagctgccattgacaaatcctagc
gagctgttaagaaagggtgcgatcactgttgaggaggcggcaaagatggaagtagagcat
aaaaacgaaataaggaacgcaagagccatgcttgttctgaagcgtatcactaacaagttg
accggtaacgacttccgcagattcaaggagctcgatgttcctgaacaagtggataaattg
atacaacaagcaacctcgatcgagaacctgtgccagcactacatcggctggtgtccgttc
tggtaa

DBGET integrated database retrieval system