KEGG   Torulaspora delbrueckii: TDEL_0F02550Help
Entry
TDEL_0F02550      CDS       T02236                                 

Gene name
TDEL0F02550
Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TDEL_0F02550 (TDEL0F02550)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDEL_0F02550 (TDEL0F02550)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TDEL_0F02550 (TDEL0F02550)
Enzymes [BR:tdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TDEL_0F02550 (TDEL0F02550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:472236..474365
Genome map
AA seq 709 aa AA seqDB search
MSKQLRQTFADAKSEGRHALVTFMTAGYPTVDDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNTVALQNGVTLKQTLDLVRQARESGVTVPIILMGYYNPVLNYGEEQFIKDAA
IAGVNGFIIVDLPPEEALKVRNYVRESGLSLIPLVAPSTTDERLELLSEIADSFVYVVSR
MGTTGAQTSVASDLGQLVTRVRKYTGDTPLAVGFGVSTREHFKDVGSLSDGVVIGSKIVT
LCGEAPKGTAYNVAKEYVEGILAGQKHKVLTKDEYYKLQTTSIEEAKQTVALLNRFNEIH
KHPSRFGEFGGQYVPEALHACLRELEAGFDDAVVDPKFWEEFRSLYPYIGRPSSLHRADR
LAEHCGGAQIWLKREDLNHTGSHKINNALAQLLLAKRLGKTEIIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVTNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKQQFAELNDGKLPDAVVACVGGGSNSTGMFS
PFEKDLSVKMLGVEAGGDGIDTKHHSATLTVGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRADFVAASDAQALQGFKLLSQLEGIIPALESSHAIYGACELA
KKMRPDQHIIINVSGRGDKDVQSVAEVLPKLGPVIGWDLRFEEDPSVGQ
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagctgagacagacgttcgcagatgccaagagtgaaggtcgtcatgcgcta
gtcacttttatgacggcaggttatcctacggtcgatgacactatcccaattctgaaaggt
tttcaagatggtggtgtcgatgtcattgaattgggtatgccattctctgatccaattgca
gatggtcctactatccaggtgtccaacactgttgcattgcaaaacggtgtcacattgaag
caaactttagatctagtgcgtcaagccagagaatcaggtgtcacggttcctattatcctt
atgggttactacaatccagttttgaactacggcgaagagcaatttatcaaagacgccgct
attgctggcgttaacggattcatcattgtggatttgccacctgaagaagcactcaaggtc
agaaactatgtaagagagtctggcctaagtttgatcccattggttgcgccatctaccact
gatgaacgtttggaattactgtcagaaatcgcagattctttcgtttatgttgtctcgaga
atgggtactactggcgctcagacttctgttgccagtgatttggggcagttggttaccaga
gtacgcaaatacaccggagatacacctctggctgtcggatttggtgtatcgactagagag
catttcaaagacgttggctctctatcagatggtgtggtcattggctcaaaaattgtcaca
ttgtgcggtgaagcaccaaagggtactgcttacaacgtagctaaggaatacgttgaaggc
atcttggctggccaaaaacataaagttttaacgaaggacgaatactacaagttgcagaca
acttccattgaagaagcaaaacagacagttgctcttttaaacagattcaatgaaattcac
aagcacccaagcaggtttggtgagtttggtggtcagtacgttccagaagctttacatgcc
tgtctgagagagttggaggctggtttcgatgacgctgttgtcgaccctaaattttgggaa
gagttcagatctctatatccatacattggccgtccctcgtctcttcacagagctgataga
cttgctgaacactgcggtggtgctcaaatttggttgaagagagaagacttgaatcacacc
ggttctcataaaatcaacaatgctttggctcagttgttgctggctaagagactgggtaag
acagaaattatcgccgagacaggtgcaggtcaacacggtgtcgccactgcgacagcgtgc
gctaaattcgggttgaagtgtactgtcttcatgggtgctgaagatgttcgtcgtcaagct
ctaaatgtctttagaatgagaatcctaggtgcaaaggttgttgcagtcactaacggtacc
aagactttgagagacgctacatctgaagccttccgtttctgggtaaccaacttaaagact
acttactacgttgtgggatctgccattggtccacatccatatccaactttggttcgtaca
ttccaaagtgtcattggccaagaaaccaaacagcaatttgctgaactgaacgatggtaag
ctgcctgacgcagtggtcgcatgtgtcggtggtggttctaactctactggtatgttctca
ccatttgagaaggatctaagtgttaaaatgctcggtgttgaagcaggaggtgacggtatc
gatacaaaacatcactctgctactcttaccgtcggtagaccaggtgtctttcacggtgtc
aagacatacgttctacaagacaacgacggtcaagttcacgacacgcattccgtttcggca
ggtcttgattacccaggtgttggtccagaattagcttactggaaatctactggtcgtgcc
gatttcgtcgctgccagcgacgcccaggccttgcaaggcttcaaactgctttctcaactt
gaaggtatcattccagctctagagtcatctcacgccatctacggtgcttgtgagttggcc
aagaaaatgagaccagatcaacacatcattatcaatgtctccggtagaggagacaaagat
gttcaaagtgtagctgaagtgttgcccaagctaggtccagtcatcggctgggacttgaga
ttcgaggaagacccttcggtgggccaatga

DBGET integrated database retrieval system