KEGG   Torulaspora delbrueckii: TDEL_0F02550Help
Entry
TDEL_0F02550      CDS       T02236                                 

Gene name
TDEL0F02550
Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00260  Glycine, serine and threonine metabolism
tdl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01230  Biosynthesis of amino acids
Module
tdl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDEL_0F02550 (TDEL0F02550)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TDEL_0F02550 (TDEL0F02550)
Enzymes [BR:tdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TDEL_0F02550 (TDEL0F02550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 11501526
NCBI-ProteinID: XP_003682277
UniProt: G8ZWS2
Position
6:472236..474365
Genome map
AA seq 709 aa AA seqDB search
MSKQLRQTFADAKSEGRHALVTFMTAGYPTVDDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNTVALQNGVTLKQTLDLVRQARESGVTVPIILMGYYNPVLNYGEEQFIKDAA
IAGVNGFIIVDLPPEEALKVRNYVRESGLSLIPLVAPSTTDERLELLSEIADSFVYVVSR
MGTTGAQTSVASDLGQLVTRVRKYTGDTPLAVGFGVSTREHFKDVGSLSDGVVIGSKIVT
LCGEAPKGTAYNVAKEYVEGILAGQKHKVLTKDEYYKLQTTSIEEAKQTVALLNRFNEIH
KHPSRFGEFGGQYVPEALHACLRELEAGFDDAVVDPKFWEEFRSLYPYIGRPSSLHRADR
LAEHCGGAQIWLKREDLNHTGSHKINNALAQLLLAKRLGKTEIIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVTNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKQQFAELNDGKLPDAVVACVGGGSNSTGMFS
PFEKDLSVKMLGVEAGGDGIDTKHHSATLTVGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRADFVAASDAQALQGFKLLSQLEGIIPALESSHAIYGACELA
KKMRPDQHIIINVSGRGDKDVQSVAEVLPKLGPVIGWDLRFEEDPSVGQ
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagctgagacagacgttcgcagatgccaagagtgaaggtcgtcatgcgcta
gtcacttttatgacggcaggttatcctacggtcgatgacactatcccaattctgaaaggt
tttcaagatggtggtgtcgatgtcattgaattgggtatgccattctctgatccaattgca
gatggtcctactatccaggtgtccaacactgttgcattgcaaaacggtgtcacattgaag
caaactttagatctagtgcgtcaagccagagaatcaggtgtcacggttcctattatcctt
atgggttactacaatccagttttgaactacggcgaagagcaatttatcaaagacgccgct
attgctggcgttaacggattcatcattgtggatttgccacctgaagaagcactcaaggtc
agaaactatgtaagagagtctggcctaagtttgatcccattggttgcgccatctaccact
gatgaacgtttggaattactgtcagaaatcgcagattctttcgtttatgttgtctcgaga
atgggtactactggcgctcagacttctgttgccagtgatttggggcagttggttaccaga
gtacgcaaatacaccggagatacacctctggctgtcggatttggtgtatcgactagagag
catttcaaagacgttggctctctatcagatggtgtggtcattggctcaaaaattgtcaca
ttgtgcggtgaagcaccaaagggtactgcttacaacgtagctaaggaatacgttgaaggc
atcttggctggccaaaaacataaagttttaacgaaggacgaatactacaagttgcagaca
acttccattgaagaagcaaaacagacagttgctcttttaaacagattcaatgaaattcac
aagcacccaagcaggtttggtgagtttggtggtcagtacgttccagaagctttacatgcc
tgtctgagagagttggaggctggtttcgatgacgctgttgtcgaccctaaattttgggaa
gagttcagatctctatatccatacattggccgtccctcgtctcttcacagagctgataga
cttgctgaacactgcggtggtgctcaaatttggttgaagagagaagacttgaatcacacc
ggttctcataaaatcaacaatgctttggctcagttgttgctggctaagagactgggtaag
acagaaattatcgccgagacaggtgcaggtcaacacggtgtcgccactgcgacagcgtgc
gctaaattcgggttgaagtgtactgtcttcatgggtgctgaagatgttcgtcgtcaagct
ctaaatgtctttagaatgagaatcctaggtgcaaaggttgttgcagtcactaacggtacc
aagactttgagagacgctacatctgaagccttccgtttctgggtaaccaacttaaagact
acttactacgttgtgggatctgccattggtccacatccatatccaactttggttcgtaca
ttccaaagtgtcattggccaagaaaccaaacagcaatttgctgaactgaacgatggtaag
ctgcctgacgcagtggtcgcatgtgtcggtggtggttctaactctactggtatgttctca
ccatttgagaaggatctaagtgttaaaatgctcggtgttgaagcaggaggtgacggtatc
gatacaaaacatcactctgctactcttaccgtcggtagaccaggtgtctttcacggtgtc
aagacatacgttctacaagacaacgacggtcaagttcacgacacgcattccgtttcggca
ggtcttgattacccaggtgttggtccagaattagcttactggaaatctactggtcgtgcc
gatttcgtcgctgccagcgacgcccaggccttgcaaggcttcaaactgctttctcaactt
gaaggtatcattccagctctagagtcatctcacgccatctacggtgcttgtgagttggcc
aagaaaatgagaccagatcaacacatcattatcaatgtctccggtagaggagacaaagat
gttcaaagtgtagctgaagtgttgcccaagctaggtccagtcatcggctgggacttgaga
ttcgaggaagacccttcggtgggccaatga

DBGET integrated database retrieval system