KEGG   Torulaspora delbrueckii: TDEL_0F02550Help
Entry
TDEL_0F02550      CDS       T02236                                 

Gene name
TDEL0F02550
Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TDEL_0F02550 (TDEL0F02550)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TDEL_0F02550 (TDEL0F02550)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TDEL_0F02550 (TDEL0F02550)
Enzymes [BR:tdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TDEL_0F02550 (TDEL0F02550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:472236..474365
Genome map
AA seq 709 aa AA seqDB search
MSKQLRQTFADAKSEGRHALVTFMTAGYPTVDDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVSNTVALQNGVTLKQTLDLVRQARESGVTVPIILMGYYNPVLNYGEEQFIKDAA
IAGVNGFIIVDLPPEEALKVRNYVRESGLSLIPLVAPSTTDERLELLSEIADSFVYVVSR
MGTTGAQTSVASDLGQLVTRVRKYTGDTPLAVGFGVSTREHFKDVGSLSDGVVIGSKIVT
LCGEAPKGTAYNVAKEYVEGILAGQKHKVLTKDEYYKLQTTSIEEAKQTVALLNRFNEIH
KHPSRFGEFGGQYVPEALHACLRELEAGFDDAVVDPKFWEEFRSLYPYIGRPSSLHRADR
LAEHCGGAQIWLKREDLNHTGSHKINNALAQLLLAKRLGKTEIIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVTNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKQQFAELNDGKLPDAVVACVGGGSNSTGMFS
PFEKDLSVKMLGVEAGGDGIDTKHHSATLTVGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRADFVAASDAQALQGFKLLSQLEGIIPALESSHAIYGACELA
KKMRPDQHIIINVSGRGDKDVQSVAEVLPKLGPVIGWDLRFEEDPSVGQ
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagctgagacagacgttcgcagatgccaagagtgaaggtcgtcatgcgcta
gtcacttttatgacggcaggttatcctacggtcgatgacactatcccaattctgaaaggt
tttcaagatggtggtgtcgatgtcattgaattgggtatgccattctctgatccaattgca
gatggtcctactatccaggtgtccaacactgttgcattgcaaaacggtgtcacattgaag
caaactttagatctagtgcgtcaagccagagaatcaggtgtcacggttcctattatcctt
atgggttactacaatccagttttgaactacggcgaagagcaatttatcaaagacgccgct
attgctggcgttaacggattcatcattgtggatttgccacctgaagaagcactcaaggtc
agaaactatgtaagagagtctggcctaagtttgatcccattggttgcgccatctaccact
gatgaacgtttggaattactgtcagaaatcgcagattctttcgtttatgttgtctcgaga
atgggtactactggcgctcagacttctgttgccagtgatttggggcagttggttaccaga
gtacgcaaatacaccggagatacacctctggctgtcggatttggtgtatcgactagagag
catttcaaagacgttggctctctatcagatggtgtggtcattggctcaaaaattgtcaca
ttgtgcggtgaagcaccaaagggtactgcttacaacgtagctaaggaatacgttgaaggc
atcttggctggccaaaaacataaagttttaacgaaggacgaatactacaagttgcagaca
acttccattgaagaagcaaaacagacagttgctcttttaaacagattcaatgaaattcac
aagcacccaagcaggtttggtgagtttggtggtcagtacgttccagaagctttacatgcc
tgtctgagagagttggaggctggtttcgatgacgctgttgtcgaccctaaattttgggaa
gagttcagatctctatatccatacattggccgtccctcgtctcttcacagagctgataga
cttgctgaacactgcggtggtgctcaaatttggttgaagagagaagacttgaatcacacc
ggttctcataaaatcaacaatgctttggctcagttgttgctggctaagagactgggtaag
acagaaattatcgccgagacaggtgcaggtcaacacggtgtcgccactgcgacagcgtgc
gctaaattcgggttgaagtgtactgtcttcatgggtgctgaagatgttcgtcgtcaagct
ctaaatgtctttagaatgagaatcctaggtgcaaaggttgttgcagtcactaacggtacc
aagactttgagagacgctacatctgaagccttccgtttctgggtaaccaacttaaagact
acttactacgttgtgggatctgccattggtccacatccatatccaactttggttcgtaca
ttccaaagtgtcattggccaagaaaccaaacagcaatttgctgaactgaacgatggtaag
ctgcctgacgcagtggtcgcatgtgtcggtggtggttctaactctactggtatgttctca
ccatttgagaaggatctaagtgttaaaatgctcggtgttgaagcaggaggtgacggtatc
gatacaaaacatcactctgctactcttaccgtcggtagaccaggtgtctttcacggtgtc
aagacatacgttctacaagacaacgacggtcaagttcacgacacgcattccgtttcggca
ggtcttgattacccaggtgttggtccagaattagcttactggaaatctactggtcgtgcc
gatttcgtcgctgccagcgacgcccaggccttgcaaggcttcaaactgctttctcaactt
gaaggtatcattccagctctagagtcatctcacgccatctacggtgcttgtgagttggcc
aagaaaatgagaccagatcaacacatcattatcaatgtctccggtagaggagacaaagat
gttcaaagtgtagctgaagtgttgcccaagctaggtccagtcatcggctgggacttgaga
ttcgaggaagacccttcggtgggccaatga

DBGET integrated database retrieval system