KEGG   Torulaspora delbrueckii: TDEL_0F02670Help
Entry
TDEL_0F02670      CDS       T02236                                 

Gene name
TDEL0F02670
Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tdl  Torulaspora delbrueckii
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TDEL_0F02670 (TDEL0F02670)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    TDEL_0F02670 (TDEL0F02670)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     TDEL_0F02670 (TDEL0F02670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(491801..492724)
Genome map
AA seq 307 aa AA seqDB search
MAYSYLTDSTYGKDNVKFLKVKKDKSNPKKHEIMEATVKVLLKGDFDVSYTEADNSPIVP
TDTVKNTILILARQYDTWPTEKFAAKLALHFTEKYGHVSGVTVQIYQDRWVKYDVDNKES
LHSFIHQGPEKKVTFLDYDKKNGPGQYFLTTNIKDLTVLKSTNSMFYGYNKCDYTTLKPT
TDRVLSTDIFALWEWSCSKLGCLKSIADGQKDSIFDSVYNTARDVTLDIFAKENSPSVQA
TMFNMATAILQKAPQVDYVTYELPNKHYFLFDLKWFKGLDNDNELFYPSPHPNGLIKCRV
GRNQSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcatactcatatctcactgatagcacttacggtaaagacaatgttaagtttttaaaa
gttaagaaggataaatcgaacccaaagaagcatgaaatcatggaagctaccgtcaaggtg
ctcctaaagggtgattttgacgtctcatacactgaggcagacaattctccaattgtcccc
actgacactgtcaagaacacgatccttattttggccagacaatacgatacttggccaacg
gaaaaattcgctgctaagttggcgctccacttcactgagaaatatggtcatgtttctggt
gttaccgtgcaaatttatcaggaccgttgggttaagtatgatgtcgacaacaaggagagt
ttacactcttttattcatcaaggcccagagaagaaagtcactttcttggattatgacaag
aaaaatggtcccggtcaatacttcttgactacaaacatcaaggatttgactgtcttgaaa
tcgacaaattccatgttttacggttacaataaatgtgattacacgactttgaaacccacc
actgatcgtgttttgtccaccgatatttttgctttatgggaatggagctgttccaaattg
ggctgcttgaaatctatcgctgacggtcagaaggattccatctttgattctgtgtacaat
actgctcgtgatgtcactttagacatcttcgctaaggagaattctccctctgtccaggca
actatgttcaacatggctactgctattttgcaaaaagctcctcaagtcgactatgttact
tacgagctgccaaacaaacattacttcttgtttgacctcaagtggttcaaagggttggat
aacgataatgagctattttatccatctccacaccctaacggactgatcaaatgtagagtt
ggtcgtaaccaatcaaaactttaa

DBGET integrated database retrieval system