KEGG   Torulaspora delbrueckii: TDEL_0F02750Help
Entry
TDEL_0F02750      CDS       T02236                                 

Gene name
TDEL0F02750
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
tdl  Torulaspora delbrueckii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TDEL_0F02750 (TDEL0F02750)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TDEL_0F02750 (TDEL0F02750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:504335..504979
Genome map
AA seq 214 aa AA seqDB search
MSVSALIVVDIQNDFLPGGSLAVPHGDEIIQPVIKLMEDPNRKWHRIILTRDWHTSDHIS
FARTHKKPDFSPITYHSVIPDDNATQEGTLWPVHCVQQTHGAQLADAIADEQKKLGCRIV
DKGYLSDREYYSAFSDIWNYHRTELNNYLDSHHITDVYVVGLALDFCVKHTALSAAKRGY
NTYILKDYTRAIHSDPESMKALEKELKENNVQLI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatcagcattaattgtagttgacattcaaaatgatttccttccaggtggatcc
ctcgctgtcccacacggcgatgaaattattcagccggtgatcaaattgatggaggaccct
aaccgcaagtggcaccgtattattctcacaagagattggcacacatcggaccacatttcg
tttgctagaacccacaagaaaccggatttctctccaattacttaccattcggtgattcca
gacgacaatgcaacccaggagggaactctatggcctgtccactgcgttcagcagactcat
ggggcccagcttgccgatgctatcgcagatgagcaaaagaagctaggttgccgtatcgtc
gacaagggctatctctcagaccgtgaatactattcggctttcagtgatatttggaactat
caccgcacagagctcaacaattacctcgacagtcaccatattaccgacgtctacgtcgtt
gggctagccttagatttctgcgtcaagcatacagcactttcagctgccaagcgtggctac
aacacttatattctcaaggactatacaagggctattcacagtgacccagaatctatgaaa
gctcttgagaaagaactcaaggagaataacgtgcaactcatctaa

DBGET integrated database retrieval system