KEGG   Torulaspora delbrueckii: TDEL_0F03190Help
Entry
TDEL_0F03190      CDS       T02236                                 

Gene name
TDEL0F03190
Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TDEL_0F03190 (TDEL0F03190)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0F03190 (TDEL0F03190)
  Lipid metabolism
   00071 Fatty acid degradation
    TDEL_0F03190 (TDEL0F03190)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TDEL_0F03190 (TDEL0F03190)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TDEL_0F03190 (TDEL0F03190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:583849..584904
Genome map
AA seq 351 aa AA seqDB search
MTTQIPKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLP
TKLPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADL
SGYTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCAGITVYKALKSANLRAGEWVAIS
GASGGLGSLAVQYAKAMGYRVLGIDGGDEKAKLFKQLGGEYFIDFTKSKDVIAEVIKATD
GGAHGVINVSVSEGAISASTRYARANGTVVLVGLPANAYCKSEVFNQVVKSVAIVGSYVG
NRADTREALDFFARGLVKSPIKIVGLSTLPEIYEKMEKGQIVGRYVVDTSK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaattccaaaaacccaaaaagctgttgttttcgacaccaatggtggtgaa
ttgcaatacaaggatatccctgttcccgaacctcaaccaaatgaacttttgatcaatgtc
aagtactcgggtgtctgccacaccgatttgcacgcctggaaaggtgactggccattgcca
actaagttgcctttagtcggtggtcatgaaggtgcaggtatcgttgttgcgaaggggtcg
atggtttnnnagggctgggaaattggtgatttggccggtattaagtggttgaatgggtct
tgtatgtcttgtgaatactgtgaaaaagctaatgaatccaactgtccacaggccgatttg
tctgggtacactcatgatggttcattccagcagtatgctactgcagatgcagttcaagcc
gctcgtgttccaaagggaactgacttagccgaagttgctcctatcctatgtgctggtatc
actgtctacaaggctttgaagtctgctaatctacgtgctggtgaatgggttgccatctct
ggtgcttccggtggtttaggttccctagctgttcaatacgccaaggcgatgggttacaga
gtcttgggtatcgatggtggtgatgaaaaggctaaattgttcaaacaattgggtggtgaa
tatttcatcgattttaccaaatccaaggatgtcattgcagaagtcatcaaggctactgat
ggtggtgctcacggtgtcattaacgtttctgtctcggaaggcgcaatctctgcttcaact
cgctacgcaagagccaacggtacagttgtgctagtcggtctaccagccaacgcgtactgt
aaatccgaagtgttcaaccaagtggtcaaatccgtcgcaatcgtcggatcatacgttggt
aacagagctgatactcgtgaagctctagatttctttgcaagaggccttgtcaaatcacca
attaagattgttggactctccactttgccagaaatttacgaaaagatggagaagggccaa
atcgtgggtagatacgtcgttgacacctccaaataa

DBGET integrated database retrieval system