KEGG   Torulaspora delbrueckii: TDEL_0F04530Help
Entry
TDEL_0F04530      CDS       T02236                                 

Gene name
TDEL0F04530
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tdl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:850198..851964
Genome map
AA seq 588 aa AA seqDB search
MSETRSSRSHTRRTSFTVGRSRSHSRSNSKSRRPSLSGKRSSQRLIRTISVDTDAFSTDD
ESKFETFSAGSESAGPTIAEDDSIVSGVTDLKLDSDRSYDSSNRMGSQTSSEVIEVPYVN
VILDSTLPQDYLKDDILNTIQSLKIPRWYVRGFSDVSPLERKLLKLTKITGAMTNVIYKV
EYPGVPSLLLRVYGPNNDSIIDRDYELEVLARLSVRNIGPSLYGCFENGRFEQFLENAQT
LSKDDIRDWKTSQRIARRMKELHKGVPLLKFEREGGPACWAKINQWINRIETRGREWVKD
DDNIRHTLLCNNWSEFKTVVEQYCNWLYGQGSSNVKKSLVFCHNDAQYGNLLFTSPVIKA
DNPIHSAPKSASSTSLFPQNSNVSLEQIINPPIQDQSQDSKLVVIDFEYAGANPAAFDLA
NHLSEWMHDYNCSEPFRCNPKKFPTKEQMLNFVYSYVSHLRGNSTTIIDDEVKHYYNAIL
KWRGSVQLFWCLWAILQSGDLQNEAVERIESKGPSGNKYIIKTELSDGIDDVALTNDELE
GVDIDTFDYLGYCKDKIALFWGDAIRFGVAHETDCIASEVKYLDTQML
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacacgttcgtctcggagccatacaagaaggacttcattcacagtgggacgt
tctcgatcccattcaagatccaacagtaagtccagaagaccttcgctttcgggtaagaga
tcttctcagcgtctaatacggaccattagtgttgatactgatgcgtttagcactgatgat
gaatctaagtttgaaaccttctctgctggttcagagtcagcggggcctacgatagcggag
gatgattcaatcgtctctggggtcaccgatttaaagttagacagcgatcgtagttacgat
agcagtaatcgtatgggctcgcagacatcgagtgaagttattgaagttccctatgtcaac
gttatcctggatagtactttaccgcaagattatttgaaggacgatattctgaataccata
caaagtcttaaaataccaagatggtacgttcgtggcttttccgatgtctcaccgttggaa
aggaaactattgaagttgaccaagatcactggtgcaatgaccaatgtaatttataaggtc
gaatatccaggagtaccatcccttttattgagagtatatggtcccaataacgattccatc
attgatagagattatgaattagaggttttggcgagattatcagtacgtaacattggtccc
tcgttgtatggttgtttcgaaaacggtaggtttgagcagttcttggagaatgcgcaaacg
ttgagtaaagatgatattagagattggaagacttcgcagagaatagcccgtagaatgaaa
gaattacacaagggtgttcctttgctgaaatttgagagagaaggaggtccagcttgttgg
gcaaagataaatcaatggataaacagaatagaaaccagaggtcgtgaatgggttaaagat
gacgacaacataagacataccctactttgcaataattggtcagagttcaaaacggtagtg
gaacaatactgcaactggttgtacgggcaaggatcatccaacgtgaagaaatctttagtt
ttttgtcataacgatgcgcaatacggtaacttattattcacttcacccgttataaaggca
gataatcccattcattctgctcccaaaagtgcatcctcaacatctttattcccccaaaat
tcaaatgtgtcgttagaacagatcatcaatccaccgattcaagatcaaagtcaagattcc
aaattagtggtcatagatttcgagtacgctggtgcaaacccggcagctttcgaccttgca
aatcatttgagcgagtggatgcatgactataactgttctgaacccttcagatgtaaccca
aagaagtttcccactaaggagcaaatgttgaatttcgtttactcctacgtttcacacttg
agaggaaactctaccactataattgatgacgaagtgaaacattactacaacgccatttta
aaatggagaggtagcgtacaattattctggtgcctatgggccatcttacagagcggagac
ttacagaatgaggctgtagaacgcatcgaatcgaagggaccaagtggtaataaatatatc
attaaaactgaactctcagatggcatagatgacgtcgcattaacaaatgatgaactcgaa
ggtgtagatatcgatacgttcgattatctggggtattgtaaggataagatcgcactattt
tggggtgacgcgattcgctttggtgtcgctcacgaaacagattgcattgcatcagaagtg
aaatacttggacactcaaatgctatga

DBGET integrated database retrieval system