KEGG   Torulaspora delbrueckii: TDEL_0F04540Help
Entry
TDEL_0F04540      CDS       T02236                                 

Gene name
TDEL0F04540
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tdl  Torulaspora delbrueckii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:tdl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tdl00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tdl00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(852092..853429)
Genome map
AA seq 445 aa AA seqDB search
MLSRSVRVSASKVLRSSALYSSRRVAVGVVSRRSVSTGLLQNGNLRVASLSGRFQPLQRR
WEATSVKVPTMAESLTEGSLKEFTKKEGEFIEQDELLATIETDKIDVEVNSPVSGTIKKL
NFKPEDTVTVGEELAQIEPGEAPASSSEAPKEEPKKEEPKKEEPKKEEPKKEEVKKEEPK
KQEASKKQEQPKKQEQPKQEAKKETSSPSFTNFSRNEERVKMNRMRLRIAERLKESQNTA
ASLTTFNEVDMSAVLEMRKLYKDEIIKKRGTKFGFMGLFSKACTLAAKDIPAVNGAIEGD
QIVYRDYTDISVAVSTPKGLVTPVVRNAESLSVLEVEEEIVRLSSKARDNKLTLEDMTGG
TFTISNGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMFLALTYDHRLL
DGREAVTFLKTIKELIEDPRKMLLF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgagatctgttcgtgtgagtgccagtaaagttctgaggtcatctgctttgtat
tcctctagaagagtggccgttggtgttgttagcagaagatcagtttctaccggattattg
caaaatggtaatttgagagtggcgagtttatcgggtagattccaaccattacaacgtcgt
tgggaagctacttctgttaaggttcctactatggccgaatctttgactgaaggttctcta
aaagagtttacaaagaaagagggagagttcatcgaacaggatgagcttttggctactatt
gagacagataagatcgatgtcgaagtcaattcgcctgtgagtggtacaatcaaaaaattg
aacttcaagccggaagatactgtcactgtgggtgaagagctagctcaaattgagcccggt
gaagcacctgcatcctcatcagaagctccaaaggaagagccaaaaaaggaagagccaaag
aaagaagagccaaagaaagaagagccaaagaaagaagaggtaaagaaggaagagccaaag
aagcaagaagcctcaaagaaacaagagcaacctaagaaacaagagcaacctaagcaggag
gcaaagaaggagacttcctccccatccttcactaacttctctcgtaacgaagaaagagtg
aagatgaaccgtatgagattgagaatcgccgaaagattaaaggagtcccaaaacactgcc
gcttctttgactactttcaatgaagttgatatgtcggccgttctagagatgagaaaattg
tacaaggatgaaattatcaagaagagaggtactaaatttggcttcatgggtctattctct
aaagcttgtactttggccgccaaggacattcctgccgtcaacggtgccatcgagggtgac
caaattgtttaccgtgattacaccgatatctcagtcgcagtctctactccaaagggttta
gttactccagtcgttcgtaacgctgagtccttgagcgtacttgaggtcgaagaggaaatc
gttcgtttgagttccaaggctcgtgacaacaagctgaccttggaagatatgactggtggt
acttttaccatctctaacggtggtgtcttcggttcactatatggtactccaatcatcaac
atgcctcaaactgcagttctaggtctacatggtgttaaagaaagacctgttaccgtgaat
ggtcaaatcgtatcaaggccaatgatgtttttggctttgacttacgatcacagattgcta
gatggtagagaagctgtcacgttcttgaagactattaaggaattgatcgaagatccaaga
aaaatgctactattctaa

DBGET integrated database retrieval system