KEGG   Torulaspora delbrueckii: TDEL_0F04910Help
Entry
TDEL_0F04910      CDS       T02236                                 

Gene name
TDEL0F04910
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0F04910 (TDEL0F04910)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0F04910 (TDEL0F04910)
   00620 Pyruvate metabolism
    TDEL_0F04910 (TDEL0F04910)
   00640 Propanoate metabolism
    TDEL_0F04910 (TDEL0F04910)
  Energy metabolism
   00680 Methane metabolism
    TDEL_0F04910 (TDEL0F04910)
Enzymes [BR:tdl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TDEL_0F04910 (TDEL0F04910)
Lipid biosynthesis proteins [BR:tdl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TDEL_0F04910 (TDEL0F04910)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(922769..924808)
Genome map
AA seq 679 aa AA seqDB search
MTVKEHKVVHEAHNVEARQAPKHFYDSQPGAGYVTDMAHYRQMYDQSINDPETFFGEKGR
EFLDWDRPFTKVKSGSLEKGDVAWFLNGELNAAYNCVDRHAFANPSKPALIYEADDEKDN
RVITFGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIPEAVVAMLAVARLGAIHSVVFAG
FSAGSLKDRVVDAGSKVVITCDEGKRGGKTVHTKKIVDEGLNGVDQVAKILVFQRTGTEG
IPMRAGRDHWWHEEAAKHRGYLPPVPCNAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLVLGTATIIFESTPAYPDYGRYWRII
ERHRATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPIAPELWEWYHDKIGNKN
CVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGVDACIIDPVTGIEIQGNDVEGVL
AVKSSWPSMARSVWENHHRYIDTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIESSLVNHENVSEAAVVGISDELTGQAVIAFVSLKDGYVQENVADCDADHITP
QNIRRELILQVRGEIGPFAAPKTIILVRDLPKTRSGKIMRRVLRKIASNEAEQLGDMSTL
ANANVVPAIISATENLIFC
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgaaagaacataaggtggttcatgaagcccataatgtggaggctcgtcaggcc
cctaaacatttttatgatagccaacctggtgctggttatgtgactgatatggcccattat
cgtcagatgtacgaccagtcgatcaatgaccctgagactttctttggtgaaaagggtaga
gagttcttggactgggacagaccatttactaaagttaaatctggatctttggaaaaggga
gatgttgcatggttcttgaatggtgaattgaatgctgcttataactgtgttgatagacat
gcgtttgccaacccatcgaaaccagcattgatctacgaagctgatgatgagaaagataac
agggttattactttcggtgaattgttgagacaggtttctgaggtggcaggtgtcctgaag
agctggggtgttaaaaagggtgataccgtggcagtctatttgccaatgattccagaagcc
gttgttgctatgttggctgtagctcgtttaggtgctattcactctgttgtctttgctggt
ttctctgcaggttctttgaaagatcgtgtggttgatgctggctccaaggtcgttattacc
tgtgatgaaggtaagagaggaggtaagactgttcacacaaagaagattgtggatgaaggt
ttgaacggtgtcgatcaggtcgctaagatcttggttttccaaagaactggtactgaaggt
attccaatgagagctggcagagatcactggtggcatgaagaagctgcaaagcacagaggg
tatttacctccagtgccttgtaacgctgaagatccattgttcttgctgtacacttccggt
tctactggttctccaaaaggtgtggttcacaccactggtggttacttgctaggcgctgct
ttgaccactagatacgttttcgatattcacccagaagacgtcctattcaccgctggtgac
gttggttggattactggtcacacttacgcactatacggtccattagttctaggtaccgct
acgatcattttcgagtctaccccagcatacccagattacggtagatactggagaatcatt
gaacgtcacagagctacccatttctatgttgcaccaactgccttgagactgatcaagcgt
gttggtgaagctgagattgccaaatatgacacttcttctctacgtgtcctaggttctgtt
ggtgaaccaatcgctccagaactatgggaatggtaccatgataagatcggtaacaagaac
tgtgttatttgtgacactatgtggcaaaccgaatccggttcccacttgattgctcctttg
gccggtgctgttccaactaagccaggttccgcaactgttccatttttcggtgttgatgcc
tgtattatcgacccagttactggtatcgagattcaaggtaacgacgtcgaaggtgttcta
gcagtcaaatcctcgtggccatcaatggccagatccgtctgggaaaaccaccaccgttac
atcgacacttatttgaagccatacccaggttactatttcacaggtgatggtgcaggtaga
gatcacgacggttactactggatcagaggtagagtcgatgatgttgtcaacgtctctggc
catagactatccaccgctgaaattgaatcatctctggttaaccacgagaacgtttctgaa
gctgccgttgtcggtattagtgatgaattgaccggtcaagctgtcatcgctttcgtatct
ctaaaggacggctacgtacaggaaaacgttgctgactgtgatgctgatcacattactcct
caaaacattcgtcgtgagttgatcttacaagttagaggtgaaattggtccattcgcagct
ccaaagacaattatcttagtcagagacctaccaaagaccagatctggtaagattatgaga
agagtcttgagaaagattgcctccaatgaggctgaacaactaggcgacatgtccaccttg
gccaatgccaatgtggttcctgccattatctctgctacagagaacctaattttttgctga

DBGET integrated database retrieval system