KEGG   Torulaspora delbrueckii: TDEL_0G00410Help
Entry
TDEL_0G00410      CDS       T02236                                 

Gene name
TDEL0G00410
Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(82945..86505)
Genome map
AA seq 1186 aa AA seqDB search
MADAITGSVTDQIDLGKHNEEILPLLDEDLEAQVVAEGGFTWHLDDWSQLTGDKYVSPRF
KIGEFEWDILLFPQGNQNRSLAVYLEPHADERLNTETGESELVNPDWFCCAQFAIVLSRP
DEDDKVHLINTSHHRFNSVDTDWGFANFIDLAYLKYPAKGRVSGILNKGRLNVTAYVRIV
KDPTGVLWHNFINYDSKKVTGYVGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGEN
PNDSVTLALQRAFYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRM
KGTSVEGKINELFVGKMKSYIRCINVDYQSVRTEDFWDIQLNVKNMRDLQTSFENYIEVE
LMDGENQYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSI
DLAPYMDSEALEQNPGPKIYKLHGVLVHTGDISTGHYYTLIKPSTKDEWYRFDDDRVWRA
TKKQIFDDNFGFDRLPDEKIRTMTREQYQDYLIQRHTNAYMLVYIAEEKEEEILQPVTEA
DVPEYVVTKVREENKERELREKEIREAHLYTNIRINSLKNFTHYQGFDTAPNVRSSLYSP
ELYAEDTLPITLKVSCKAYMKDIYKKINEQLNIPHGRNVRYWKMGYRRNGTLRLEEPLPL
AFEEMTLEETFENESSGKVPSLNVFVEEPYLELGFLHKLKKSGAFPSVENNDELIDNFRN
SISSIVSPDNIPTVKDDDNYQVIFLKQFDPLQQSLMGYSYCVVNQLDDISKLSQIVSEFI
GSSQPVQFYEELQPGAIEPISLKEKFYTAELSSGDILTFQTPESSLPDSFPIYKDLKSFY
EYLRNRTKLVFTKAESPSEEYVVENIESENFEFWISTKASYSDVARVVSQYTGVQPEYLK
IFAVYANGRFPMKSDSPLSDYIIRDYNSDLKPLFEYEVLSIPLKELEHLRSLKFYWLNDS
YIHFQTYEFKVTETCTVKEFLDKVQAKIGFSDKDKGNILLWTNYNFQFRGILSENSTMKS
VSKSVLLFGRILPEELKLVKQLDTLSNADEDSMDDDEEDLGVKVNGPKTELQGCVVMVAQ
YFKDIENRHGISFLFKLVPNEPFPQTRARLHEKFGLGQREFAKIHLAISFATPTGSSFRS
LEGYSKEELEKLVLFNVMSNLDCIYMDHPDRLRSQSSHDRPMVIKN
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgcaatcactggcagtgttacggatcaaatcgatctagggaagcacaatgaa
gagatccttcctctgctagatgaggatttagaagcacaagtagtggcagaaggtggattt
acgtggcatctagacgattggtcacaattaactggtgacaagtatgtttctccgaggttt
aagatcggagagtttgagtgggacatattgttatttccacaagggaaccagaacaggagt
ctggcggtttatttggagccacacgcagatgaaagattgaatacagagactggtgaaagt
gagctggtgaatcctgactggttctgttgtgcccagttcgccattgtgctttcaaggccg
gatgaggacgataaagtgcatctaatcaacacttcccatcataggttcaattcagtggat
acagattgggggtttgccaatttcattgatttagcttacttgaaatatccagctaaagga
agagtctctggtatattgaacaagggaagactaaacgtcacagcgtacgtgcgaatcgtt
aaggatcctactggagtgctttggcataacttcatcaattatgactccaagaaggtgact
ggctatgtagggttcagaaatcaaggtgctacttgttatttgaactccttgttgcagtcg
tactatttcaccaagtattttagaaggctagtataccaaatacccacggaaggcgagaat
ccaaatgatagtgtcacattggccctgcagagggctttttatcagttgcaggtttcccag
ttcccactcgacactatggagctgacaagatcatttggttgggataacgctgaagcgttt
acacaacacgatgtacaggaactgaataggatcttgatggacagattagagacacggatg
aaggggacttctgttgagggaaagatcaacgaactgttcgtgggaaaaatgaagagttat
attaggtgcattaacgtcgattatcagtcggttagaaccgaggatttctgggatattcaa
ctgaatgtgaagaatatgagagatctgcaaacttctttcgagaattatatcgaagttgaa
ctcatggatggtgaaaatcagtatgccgcccaggggcatggcctacaagacgcaaagaaa
ggtgtggtctttgaatccttcccaccggtgttgcatttgcagctgaaaaggtttgagtac
gactttaattatgaccagctgatcaaggttaatgaccgctacgaatttccagattccatt
gatttggccccatatatggatagtgaagcactggagcaaaatccggggccgaagatttat
aaactgcatggtgtcctggtacacactggagatatctcgaccggtcattactacacccta
ataaaaccaagtacaaaggacgaatggtaccgttttgatgatgatagggtttggagggct
accaagaagcaaatttttgatgataactttgggttcgataggttaccagatgagaagatt
cgcacgatgaccagggagcagtaccaggattacttgatccaacgccatactaatgcgtat
atgctcgtctatattgctgaagagaaagaagaagaaattcttcagcctgtaacagaagcg
gatgttccagaatatgttgtcaccaaggttagggaagagaacaaagagcgtgagttgaga
gaaaaagagatccgtgaagctcatttgtacacaaacattcggatcaattctctgaagaat
ttcactcattaccagggttttgacactgcacccaacgttcgttcatcactttactctcca
gagctgtacgcggaagatactttacctatcactctaaaagtttcgtgcaaggcatacatg
aaagatatctacaagaagataaatgagcagctaaacatacctcatggcaggaatgtgaga
tactggaaaatgggttaccgtagaaatggaactttgcgtttagaagaacctcttccgctg
gcgtttgaagaaatgacattagaagagacttttgaaaacgaaagttcagggaaggttcct
tcactaaatgtgtttgttgaagagccttatttggagctcgggtttttgcataaattaaag
aagtcaggcgcatttccctcagtggaaaataatgacgagctcattgataacttcaggaac
agcatctcatccatagtttcaccagacaatattccaacagttaaggatgatgataattac
caagtgatattcctgaaacaatttgatcctctacaacaatctttgatgggctattcttat
tgtgtggtgaaccagctggacgacatatctaaactatcgcagattgtcagtgaattcatt
ggttcatctcaacccgtgcagttttacgaagaacttcaaccaggggcaattgaacccata
tctctgaaggagaagttttatacggcagaactctcctcgggtgatatacttacgtttcaa
acccctgagtcaagtcttcccgacagttttccaatttacaaagacttgaagtcgttttac
gaatacttaaggaatagaactaagcttgtcttcacgaaagctgaaagtccaagcgaggaa
tacgtggtagaaaatatagaatctgaaaatttcgaattctggatatcaaccaaggcaagc
tactcggatgtcgcaagagttgtgtcacaatacactggtgttcaaccagagtacctaaag
atttttgccgtttatgccaatgggagatttcccatgaaatcggattctccgttaagtgac
tacatcattagagattacaattcagacttgaagccattattcgagtatgaagtcctctcg
attcctctcaaagagctggagcatttgaggtccttgaaattttattggttgaatgatagc
tatattcactttcaaacttacgaattcaaggtaacagagacttgcaccgtgaaggaattt
ctggataaggttcaagccaaaattggtttttccgataaagataaaggaaacattcttcta
tggactaattacaactttcaattcaggggtatactatcagaaaacagcactatgaaaagt
gttagtaaatctgtgttgttatttggacgaatactcccggaagagctcaagttggtaaaa
cagttagacactctgtctaatgctgacgaagattcgatggatgatgacgaagaggatctt
ggggttaaagtgaacggtccaaaaactgaactgcaaggttgtgtcgtgatggtcgcccaa
tacttcaaagacatagagaatagacatggtatctccttcttattcaagttagtaccaaac
gagccttttccacaaaccagggctcgattgcatgaaaaattcggcctgggacaaagggag
tttgccaaaatacatttagccatttcctttgcaaccccgactggatcgtccttcaggtcc
ttggaaggttattccaaggaagagttggagaaactcgttctcttcaatgtgatgagtaac
ctagattgcatttacatggatcatcctgacagattgagatcacaaagctcccatgataga
ccgatggttatcaaaaactaa

DBGET integrated database retrieval system